Главная Настройка Mobile Контакты NSFW Каталог Пожертвования Купить пасскод Pics Adult Pics API Архив Реквест доски Каталог стикеров Реклама
Доски


[Ответить в тред] Ответить в тред

Check this out!


[Назад][Обновить тред][Вниз][Каталог] [ Автообновление ] 513 | 78 | 151
Назад Вниз Каталог Обновить

Глупых вопросов тред Создатель !!lwTBYDyD2I 10/04/17 Пнд 11:45:22  409550  
14903651537050.jpg (36Кб, 1920x1080)
Здесь ты можешь написать глупый вопрос, но не глупый ответ.
Аноним 10/04/17 Пнд 11:50:58  409554
Почему Думсдей не может умереть?
Аноним 10/04/17 Пнд 13:39:02  409558
>>409554
Потому что ебал твою мамашу
Аноним 10/04/17 Пнд 14:00:38  409561
>>409554
Создатель Думсдэя — загадочный инопланетный учёный по имени Бертрон, который хотел создать существо, являющее собой вершину эволюции. Для этого Бертрон и его команда отправили ребёнка на поверхность планеты, где он бы сразу умер в жестокой окружающей среде или от злобных хищников. Процесс повторяли множество раз — раз за разом останки ребёнка собирали и для искусственного ускорения эволюции клонировали. Десятки лет существо было вынужденно терпеть смертельные агонии тысячи тысяч раз, каждая из этих смертей генетически записывалась в его памяти, и из-за этого существо возненавидело всю жизнь и всех живущих.
Аноним 10/04/17 Пнд 14:43:00  409562
>>409550 (OP)
> Создатель !!lwTBYDyD2I
Кто такой? Чем знаменит?
Аноним 10/04/17 Пнд 14:46:44  409563
>>409550 (OP)
Есть ли дисперсия света в вакууме?
Аноним 10/04/17 Пнд 18:27:39  409570
сколько дней проходить одну тему по химии
Аноним 10/04/17 Пнд 18:29:46  409571
Capturessssssss[...].PNG (36Кб, 714x443)
как решить это
Аноним 10/04/17 Пнд 19:23:42  409574
пространство объективно или субъективно? и почему? анон, поделись своим мнением, а то друзей нет, а услышать чье-то мнение очень хочется.
может, не на ту доску попал, но тред точно верный.
Аноним 10/04/17 Пнд 19:46:24  409576
>>409574
>пространство объективно или субъективно?
Хуй знает что ты этим имел ввиду, но я считаю, что пространство многогранное, многослойное и всё связано.

Аноним 10/04/17 Пнд 20:32:13  409577
>>409563
нет
Аноним 10/04/17 Пнд 22:05:45  409584
>>409577
А если найду? А ты попрыгай!
Аноним 10/04/17 Пнд 22:06:25  409585
>>409584
найди
Аноним 11/04/17 Втр 07:49:37  409618
Что будет, с сингулярностью, когда черная дыра подвержется полному изучению Хокинга?
Аноним 11/04/17 Втр 14:56:43  409646
>>409571
Учебник открой.
Аноним 11/04/17 Втр 15:29:54  409649
Что будет, если сожрать много желатина? Я стану желейным тентаклиевым монстром?!
Аноним 11/04/17 Втр 18:22:54  409658
>>409649
>Что будет, если сожрать много желатина?
Ты блеванешь.
Аноним 11/04/17 Втр 21:00:58  409666
>>409618
У меня есть гипотетическая хуйня У меня есть другая гипотетическая хуйня Тыц-Тыц ... Научная Фантастика! Тыц-Тыц...
Аноним 11/04/17 Втр 21:37:01  409668
Это у меня не совсем глупый вопрос, но всё же задам его здесь: существует ли возможность создать некий чип, записать на него приватный ключь и программу, таким образом, что бы ни ключ, ни программу нельзя было оттуда достать и зареверсинженирить?
Аноним 11/04/17 Втр 22:03:43  409669
>>409668
Можно сделать носитель достаточно хрупким, чтобы он работал, но при любой бомбардировке частицами рассыпался.
Аноним 12/04/17 Срд 16:52:19  409712
mkA039.gif (57Кб, 1427x2165)
>>409550 (OP)
>"Коэффицент масштаба показывает, сколько единиц измеряемой по данной оси величины содержится в однмо миллиметре. В данном случае по обоим осям он 0,05."
5\0.05 = 100 мм. А что с осью х? 2\0.05 = 40 мм. То есть они по 10 см и 4 см соответственно? Объясните позязя, я непонимат.



>Сила тяги реактивного двигателя
Как её рассчитать, а не измерить с помощью диностенда? Брать массу ракеты, умножать на ускорение этой ракеты и получим силу тяги двигателя в кг\с? Так? Или я где-то ошибся?
Аноним 12/04/17 Срд 16:53:17  409713
>>409712
Насчет 1 - там просто не указаны параметры графика и не сказано, используются ли они вообще в расчете.
Аноним 12/04/17 Срд 18:53:26  409725
>>409712
Ты привел формулу тяги без воздействия внешних сил, на Земле у тебя как минимум будет действовать гравитация. Поэтому гугли формулу Циолковского
Аноним 12/04/17 Срд 18:59:09  409728
>>409725
Она же нужна банально для сравнения.
Аноним 13/04/17 Чтв 00:45:06  409754
анон, если наблюдатель и факт наблюдения влияют в квантовой физике на результат эксперимента, т.е. на реальность, можно ли таким образом "управлять реальностью" .
Аноним 13/04/17 Чтв 01:13:54  409755

нашел тред. снимаю пока вопрос свой
>>409754
Аноним 13/04/17 Чтв 06:47:24  409759
>>409550 (OP)
>Геном — совокупность наследственного материала, заключенного в клетке организма[1]. Геном содержит биологическую информацию, необходимую для построения и поддержания организма.
Что это за "биологическая информация"? Это что то метафизическое? Как я себе всё это представляю. Геном это прост кусок материи ни чем по сути не отличающийся от куска говна, гвоздя или CD диска, но вот тут написано что в нём есть еще какая то информация причём биологическая что это значит?
Аноним 13/04/17 Чтв 12:59:24  409776
1492077556919.jpeg (106Кб, 968x1291)
>>409550 (OP)
Почему водяные капли на стене сразу не скатываются вниз? И почему капли с широким хвостом держатся дольше тех, что с узким?
Аноним 13/04/17 Чтв 13:10:40  409777
>>409776
Адгезия и когезия.
Смачивание зависит от соотношения между
силами сцепления молекул жидкости с молекулами (или атомами) смачиваемого тела (адгезия)
и силами взаимного сцепления молекул жидкости (когезия).
Аноним 13/04/17 Чтв 13:35:19  409780
na-etom-izobraz[...].jpg (62Кб, 400x306)
060[1].jpg (134Кб, 715x417)
900px-Biologica[...].png (164Кб, 900x410)
bodycell3-298x3[...].jpg (32Кб, 298x300)
>>409759
Организм состоит тканей, а ткани - из клеток.
В клетках - есть ядра, и митохондрии.
В митохондриях - РНК и кольцевая ДНК,
в ядрах клеток - хромосомы, внутри которых скрученная ДНК.
Аноним 13/04/17 Чтв 13:41:28  409783
chr1[1].jpg (35Кб, 493x468)
DNAtranscriptio[...].png (68Кб, 1000x552)
9[1].png (14Кб, 418x310)
image15.1[1].jpg (159Кб, 620x350)
>>409780
ДНК состоит из нуклеотидов, которые представляют из себя комплементарные азотистые основания.
Они, в свою очередь укреплены фосфатными группами дезоксирибозы.
А фосфодиэфирные связи между этими группами - закручивают нуклеиновые кислоты
в спиральную структуру.
В результате - образуются длинные спиралеподобные молекулы внутри органоидов клеток.
>>407580 ——> >>407581 >>407582
Достаточно большие последовательности из нуклеотидов, представляют из себя аллели генов,
которые при транскрипции выдают РНК.
А при трансляции этих РНК - в рибосомах клетки синтезируются белки.
Процесс транскрипции РНК из ДНК и/или трансляции белка из РНК - называют экспрессией гена ДНК.

Таким образом, каждый ген РНК и ДНК - кодирует конкретный белок.
А вот те или иные белки уже определяют развитие клетки и организма вцелом,
как-бы программируя биохимические реакции и всё такое прочее.

Можно сказать и так: в ДНК содержится информация, представляющая из себя программу,
по которой живут клетки организма.
Аноним 13/04/17 Чтв 13:41:45  409784
Были видео лекции о теории подобия в физике, типа уравнениями максвелла можно описать как электродинамику, так гидродинамику и т.д.
Где найти-то их?
Аноним 13/04/17 Чтв 14:13:44  409788
Можно ли близрукому/дальнозоркому человеку подобрать несфокусированное фото, которое он будет видеть чётко?
Аноним 13/04/17 Чтв 14:32:28  409791
>>409783
Я не понял. Что за программа, в каком смысле днк её содержит, и вопрос про информацию помоему в твоём тексте вообще не затронут. Я себе всегда представлял днк просто плавающую в клетке хуйню и есть ещё хуйни в клетке которые плавают вокруг и чисто случайно к днк прилепляются, вокруг так же плавают всякие другие хуйни которые так же случайно залетают в эту хуйню и пока она катается по днк слепляются во что то там и т.д. Принцип такой же как в урагане, тарелке с супом, пробирке с реагентами и т.д. Биологи предполагают что то еще плюсом к законам физики, некую метафизическую "программу"/"информацию" которая управляет атомами в клетке?
Аноним 13/04/17 Чтв 15:09:12  409794
nn.3566-SF2[1].jpg (550Кб, 946x681)
ocZki.png (655Кб, 1742x1741)
AminoAcidJargon[...].gif (9Кб, 400x538)
>>409791
Загугли все непонятные слова из поста, и поймёшь.
Ещё раз:
ДНК - содержит гены.
Гены - кодируют белки.
Как гены кодируют белки? А вот так вот:
При экспрессии генов - идет трансляция РНК, а при транскрипции РНК - синтезируется белок.
Какой белок - зависит от последовательности нуклеотидов в аминокислотной секвенции аллели гена.
А там уже гугли amino acid sequence.
Вот тебе и информация.
Это всё - в двойной спирали хромосом.
А органоиды уже от ядра отделяются, когда клетка растёт.

Аминокислотные секвенции, как правило представляют из себя последовательности
комплементарных азотистых оснований в нуклеотидах двойной спирали.
Этих оснований 4. Аденин (A), гуанин (G), цитозин (C), тимин (T). В РНК - вместо тимина - урацил (U).
Вот они, на второй картинке, в центре. A, G, C, U.
Более сложные комбинации, например из трёх нуклеотидов (кодоны),
кодирующие аминокислоты белков протеинов -
в аминокислотных секвенциях кодируются латинскими символами, как правило.
http://www.cbs.dtu.dk/courses/27619/codon.html

Ну и в заключение - вот, я тебе из треда про биологического бессмертие -
принёс аминокислотную последовательность того самого пептида, что на ОП-пике там.
FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP
Вся суть программы в ДНК.
Аноним 13/04/17 Чтв 15:10:53  409795
>>409794
>При экспрессии генов - идет трансляция РНК, а при транскрипции РНК - синтезируется белок.
Там наоборот чуток. Транскрипцию с трансляцией попутал, бля.
При экспрессии генов ДНК идёт транскрипция их в РНК, а при трансляции белка из РНК - производится белок.
самофикс
Аноним 13/04/17 Чтв 15:47:10  409798
А все ли породы собак скрещиваются? Пекинес с Сербернаром даст плодовитое потомство?
Аноним 13/04/17 Чтв 16:08:18  409800
>>409794
Ты тролишь? Ты просто копипастишь какую то левую хуйню не имеющую отношения(а если по твоему имеет то проведи связь, плиз). Я нигде не нашёл разъяснение того, что биологи вкладывают в понятия информации, программы. Это просто жаргон и метафоры или есть какой то особый смысл? Я не знаю влияет ли это на смысл и суть того что ты пытаешься донести, но белок не однозначно определяется геном, на каждом этапе дохуя регуляций, какой будет белок в степени не сильно меньшей от последовательности нуклеотидов зависит от дохуя еще каких факторов. Только я не понимаю какое это имеет отношение.
Аноним 13/04/17 Чтв 16:45:19  409805
>>409800
>Ты тролишь?
Нет.
>Ты просто копипастишь какую то левую хуйню не имеющую отношения(а если по твоему имеет то проведи связь, плиз).
Не знаю как у тебя, а у меня всё это укладывается в башке. Если что - задавай вопросы, постараюсь ответить.
>Я нигде не нашёл разъяснение того, что биологи вкладывают в понятия информации, программы.
>Это просто жаргон и метафоры или есть какой то особый смысл?
Это всё же - на внутриклеточном уровне.
>Я не знаю влияет ли это на смысл и суть того что ты пытаешься донести,
>но белок не однозначно определяется геном
>на каждом этапе дохуя регуляций,
>какой будет белок в степени не сильно меньшей от последовательности нуклеотидов
>зависит от дохуя еще каких факторов.
Это всё - производные от синтезируемого белка реакции.
Основные реагенты - синтезируемые в рибосомах белки, которые насыщают цитоплазму клеток,
когда РНК этих белков - прут из ядра в результате транскрипции ДНК внутри ядра.
Вот возьми и найди рибосомы на пике 3 постов >>409780 и >>409783, они там есть.
И увидишь.

Белок определяет структура и последовательность аминокислот внутри этой структуры
(смотри пик4 поста >>409783, для этого же пикчи вставил),
а вот уже эта последовательность аминокислот, в свою очередь - чётко задаётся
последовательностью нуклеотидов в РНК при синтезе и трансляции белков внутри клетки.
Для этого - глянь статью https://ru.wikipedia.org/wiki/Матричная_РНК

Аноним 13/04/17 Чтв 16:58:09  409806
14859012013440.jpg (47Кб, 598x564)
>>409805
>Нет.
Троля ответ. Еще ответы будут?
это какой то персонаж у вас тут? Как вы его называете? Просто я два раза подряд один и тот же вопрос задаю и оба раза он какую то левую фигню хуячит, такое чувство что он сам с обой разговаривает
А вопрос остаётся. Задам его в третий раз, Когда биолог затирает про какую то там информацию в геноме, он действительно говорит про какую то метафизическую сущность или просто метафорой пользуется, как когда говорит про "желания генов", "эгоизм генов"?
Аноним 13/04/17 Чтв 17:12:30  409808
>>409806
Лол.
>Троля ответ.
Я тебе уже всё подробно пояснил про программирование структур белков
аминокислотными последовательностями ДНК на биохимическом уровне.
>персонаж
>левую фигню хуячит
>сам с обой разговаривает
Не умеешь гуглить незнакомые слова?
>Когда биолог затирает про какую то там информацию в геноме,
>он действительно говорит про какую то метафизическую сущность или просто метафорой пользуется.
И то и другое. Просто чтобы не пояснять всё это детально, ибо смысла нет, потому что всё равно ты скажешь: Трол.
>как когда говорит про "желания генов", "эгоизм генов"
Это и желания и эгоимз, как правило гормонами регулируются, а гормоны синтезируются из аминокислот,
что в аминокислотных последовательностях ДНК там.
Как правило это белки, белково-пептидные соединения, стероиды или производные аминокислот.

По химическому строению известные гормоны позвоночных делят на основные классы:
Стероиды
Производные полиеновых (полиненасыщенных) жирных кислот
Производные аминокислот
Белково-пептидные соединения.

Аноним 13/04/17 Чтв 18:25:20  409815
22133711-Geothe[...].jpg (348Кб, 1300x866)
Каковы минусы эукариотизма? Что конкретно мы проебали при переходе к нему и почему потеря именно этих свойств была неизбежна?
Аноним 13/04/17 Чтв 18:32:43  409819
>>409806
>>409808
Два дебила - это сила.
Аноним 13/04/17 Чтв 18:57:09  409824
>>409754
Наблюдатель влияет физически, а не волшебно, он совершает физические действия, которые влияют на эксперимент. Это как папка выебал хуем мамку и получился ты, так и "наблюдатель" включил прибор, излучение которого физически повлияло на частицу что она изменилась и стала вести себя иначе.
Аноним 13/04/17 Чтв 18:58:22  409825
>>409759
Поддерживаю тебя братишка, я вот недавно на вики вот такую фигню прочитал:
>Книга — один из видов печатной продукции: непериодическое издание, состоящее из сброшюрованных или отдельных бумажных листов (страниц) или тетрадей, на которых нанесена типографским или рукописным способом текстовая и графическая информация
Что это за "текстовая и графическая информация"? Это что-то метафизическое? Как я себе всё это представляю. Книга это прост кусок материи ни чем по сути не отличающийся от куска говна, гвоздя или CD диска, но вот тут написано что в ней есть еще какая то информация причём текстовая или графическая, что это значит?
Аноним 13/04/17 Чтв 19:04:03  409826
Человек это бездушный биоробот или имеет душу?
Аноним 13/04/17 Чтв 19:09:41  409828
>>409826
Дай определение души.
Человек это робот в любом случае.
Аноним 13/04/17 Чтв 19:22:47  409829
>>409828
Душа это то что чувствует. Например, я вижу красный цвет и чувствую его красность. А робот разве так может? Для него цвет это просто набор байтов, сухая информация, никакой красноты она не несет.
Аноним 13/04/17 Чтв 19:26:24  409830
>>409829
Может. Он видит точно такой же спектр как и ты.
Да же больше скажу-он может видеть гораздо больше цветов, которым человек даже не дал название.
Твоя красность суть удел графического двигла, кой приоритетно развилось в человеке в силу эволюции.


Аноним 13/04/17 Чтв 19:26:55  409831
>>409788
бамп
Аноним 13/04/17 Чтв 19:28:58  409833
>>409831
Нет.
Все тупо зависит от обработки сигнала. Воображение, вот это вот всё.

Я еще не упоминаю условия просмотра, ведь причинность близорукости-дальнозорки может быть абсолютно разной.
Аноним 13/04/17 Чтв 19:36:36  409835
>>409830
Робот получает с датчиков обычный набор байтов. Как он с этого набора байтов, который обозначает красный цвет, получит ощущение красноты, которую чувствует человек?
Аноним 13/04/17 Чтв 19:53:20  409837
>>409759
Чёткого определение понятия информации отсутствует, а сам процесс определения уже давно является дисциплиной специальной олимпиады, 99% людей пользующихся этим понятием после просьбы их хоть как то его определить впадают в ступор. Даже не пытайся. 100% биологов отвечая на твой вопрос начнут тараторить зазубренные тексты о том как как это магическая информация записывается в геном, как считывается, чем подробнее ты их будешь расспрашивать тем глубже в химию, а затем и в физику они будут закапываться, а потом окажется что информации то и нет как таковой, это по сути просто словоблудие, просто удобное для людей абстрактное понятие лишённое физического смысла.
Аноним 13/04/17 Чтв 19:54:19  409838
>>409835
Логический аппарат создает из последовательности битов внутреннее представление.
Что же касается
>как он получит представление как у человека
Тр нужно, чтобы логика организации измерений датчика была идентича человеческому восприятию.
Аноним 13/04/17 Чтв 19:56:36  409839
>>409835
Также, как и ты. Ты тоже получаешь еденицы информации-потоки фотонов, которые проходят через твою камеру-глаз, и затем обрабатываются в абстракции множественных видов(ассоциации. символизмы).
Только мозг этот процесс на автомате производит, не напрягая тебя с вычислениями и обраткой. Именно поэтому ты не видишь байты, но привичную каждому человеку графическую картинку мира. Робот точно также сможет видеть такую же картину через датчики, камеры и так далее. Только он сможет контролировать, переключать и всячески взаимодействовать с процессом, видя и мегапиксели, и байты и еще кучу всего.


Ну вообще, конечно же доля философии в этом есть, у каждого разное видение и все зависит от субъекта.
Аноним 13/04/17 Чтв 19:57:07  409840
ddd.png (1221Кб, 1013x588)
>>409829
>Душа это то что чувствует.
> я ... чувствую ...
>душа это я
Ну тогда человек - вот это вот тело, гомо сапиенс, имеет душу. Дело закрыто.
Аноним 13/04/17 Чтв 20:08:31  409841
>>409838
Масло маслянное. Рекурсия.
Аноним 13/04/17 Чтв 20:16:04  409842
>>409839
>Робот точно также сможет видеть такую же картину через датчики
Ну видеть он сможет, но вот чувствовать увиденное как человек - нет, потому что в обработке байтов нет ничего, что напоминает чувства. Если я говорю хуйню, то покажите мне простейший алгоритм или процесс, который порождает чувство красноты или любое другое.
Аноним 13/04/17 Чтв 20:30:42  409845
>>409842
а)Мы говорим пока что о гипотетическом роботе и машине. Это все всго лишь гипотезы и фантазии. Мы можем только предпологать как всё будет и будет ли вообще.
б)Краность. я тебе уже сказал-не чувство. А видение различности света.
в)Под чувствами ты можешь иметь ввиду символизм. Но символизм это всего лишь ассоциативность информации.
Ты видишь желтый жар, паралелльно в твоем мозгу всплывают объекты разных групп и подгрупп с похожими свойствами. Солнце-желтное. Солнце-круглое или шарообразное.
Где ты видел солнце в последний раз? Ага, на картинке. Значит и вспомнишь картинку. А что было на картинке?-и так далее и так далее.
Все тупо зависит от типов мышления.


Аноним 13/04/17 Чтв 20:42:05  409849
>>409759
Кароч смотри. ДНК состоит из генов и прочей хуйни, ген - это совокупность азотистых оснований. Количество и последовательность этих оснований и есть код гена. Например АА ГГ ЦЦА - аминокислота "анальная смазка" и т.д.
Аноним 13/04/17 Чтв 20:55:34  409855
Что было бы если бы скорость света была отрицательной?
Аноним 13/04/17 Чтв 20:57:15  409856
>>409842
Можно ли доказать факт чувствования?
Аноним 13/04/17 Чтв 20:57:47  409857
>>409855
Очевидно мы бы тогда не видели света, так как он шел бы внутрь. Тогда не было бы ничего живого. Какой-то очень тупой вопрос.
Аноним 13/04/17 Чтв 20:58:09  409858
как трхнуть тян
Аноним 13/04/17 Чтв 20:58:42  409859
>>409856
Без эмпирики-нет.
Статистически можно попробывать, но статистика, ну ты понимаешь...
Аноним 13/04/17 Чтв 20:59:31  409860
>>409858
Поднять кровенное давление в своем пенисе, попросить тян засунуть его куда надо. Затем делаешь фрикции и после эакуляции ты можешь получать свою ачивку.
Аноним 13/04/17 Чтв 21:04:33  409861
>>409860
если она не хочет
Аноним 13/04/17 Чтв 21:17:59  409864
>>409857
>тупой вопрос
я старался
посмотри на название треда и не тупи
Аноним 13/04/17 Чтв 21:18:57  409865
>>409864
Обычно я всегда говорю что глупых вопросов не бывает.
Но ты убедил меня в обратном. Хех. Мда.
Создатель !HOHLOVz6ow 14/04/17 Птн 11:53:01  409893
При включенном и выключенном свете электрон проявляет свойства волны, а при просмотре только свойства частицы. Почему так? Ведь свет уже отразился от электрона и по идее никак с ним не связан, но почему-то он начинает проявлять свойства частицы.
Аноним 14/04/17 Птн 12:40:38  409895
>>409893
>Почему так?
Потому что ты опять не сделал уроки
Аноним 14/04/17 Птн 12:59:50  409896
>>409791
Давай я попробую. Представляешь себе, как компьютер считвает программу с перфокарты? ДНК, по сути, та же перфокарта - клетка, чтобы "узнать", какой белок ей синтезировать, "обращается" к ДНК, "пробегая" ее последовательно, как по перфокарте.

Теперь вопрос к тебе. Есть ли информация в перфокарте, это же просто кусок бумаги?
Аноним 14/04/17 Птн 13:51:51  409902
>>409896
Нет.
Аноним 14/04/17 Птн 14:06:31  409903
samplef5a76ea40[...].jpg (695Кб, 850x1236)
Как вещество становится радиоактивным? Вот например вода это Н2О. Каждый ее атом это просто электрон, протон и нейтрон. Что с ними случается когда вода становится радиоактивной? Какие перемены происходят в этих электронах, нейтронах, протонах.
Аноним 14/04/17 Птн 14:56:31  409910
>>409903
Это вещество при должной реакции выпускает высокочастотные электромагнитные волны. Вот ты, высвобождая АТФ, тоже излучаешь тепловые электромагнитные волны, только у них частота поменьше радиации будет. Кароче вещество устроено так, что может выпускать радиацию при должной манипуляции.
Аноним 14/04/17 Птн 15:42:53  409915
>>409903
Кидаешь в воду уран и вот тебе радиоактивная вода

>>409910
Он не то имел ввиду
Аноним 14/04/17 Птн 15:44:16  409916
>>409915
>Он не то имел вви
>>409910

Как раз то. Я хотел чтоб мне подробнее пояснили про
>вещество устроено так, что может выпускать радиацию при должной манипуляции.
что происходит что оно начинает выпускать
Аноним 14/04/17 Птн 15:54:45  409918
regnumpicture14[...].jpg (18Кб, 700x525)
>>409903
>Вот например вода это Н2О.
Обычная вода не радиоактивна.
Радиоактивной водой является вода, содержащая вместо водорода, радиоактивные изотопы водорода, например дейтерий и тритий.
D2O, HDO, THO, TDO и T2O,
либо радиоактивный кислород, но радиоактивный кислород быстро распадается.
https://ru.wikipedia.org/wiki/Изотопы_кислорода#.D0.A2.D0.B0.D0.B1.D0.BB.D0.B8.D1.86.D0.B0_.D0.B8.D0.B7.D0.BE.D1.82.D0.BE.D0.BF.D0.BE.D0.B2
Радиоактивность воды при этом обусловлена периодом полураспада ядер атомов радиоактивных изотопов,
составляющих молекулу.
> Каждый ее атом это просто электрон, протон и нейтрон.
Это не так.
>Как вещество становится радиоактивным?
Ну, например... Наведённая радиоактивность!..
Аноним 14/04/17 Птн 16:35:39  409923
>>409918
>Радиоактивной водой является вода, содержащая вместо водорода, радиоактивные изотопы водорода, например дейтерий и тритий.
>D2O, HDO, THO, TDO и T2O,

То есть в фолауте у нас в озере D2O вместо обычной воды и из Фукусимы тоже D2O журчит?
Аноним 14/04/17 Птн 18:10:33  409940
>>409923
Не обязательно D2O, чаще всего DHO, потому что в D2O надо чтобы два дейтерия было в молекуле,
а его процентное содержание по сравнению с водородом - маленькое.
Уж тем более реже встречается T2O, в основном THO и TDO - реже.
Аноним 14/04/17 Птн 18:11:37  409941
>>409923
И ваще, тяжёлая вода, походу — на то и тяжёлая, что она на днище уходит.
Аноним 14/04/17 Птн 18:26:20  409945
bnmb63-~1.GIF (1026Кб, 200x152)
>>409941
>И ваще, тяжёлая вода, походу — на то и тяжёлая, что она на днище уходит.
То есть если в чернобыле из озера зачерпнуть чуток с самого верха, то пить можно?
Аноним 14/04/17 Птн 19:01:07  409947
>>409945
Плотность у тяжелой и полутяжёлой воды не сильно отличается + конвекционные потоки учти.
Вода: 0,9982 г/см3
Тяжелая вода - 1,1042 г/см3

Лучше перегнать в дистиллированную. Потому что там другие радиоактивные ионы.
В результате аварии произошёл выброс в окружающую среду радиоактивных веществ, в том числе изотопов урана, плутония, йода-131 (период полураспада — 8 дней), цезия-134 (период полураспада — 2 года), цезия-137 (период полураспада — 30 лет), стронция-90 (период полураспада — 28,8 лет) и теллура.

А вообще, есть дозиметры.
Аноним 14/04/17 Птн 22:47:03  409964
>>409918
Дейтерий же не радиоактивный нихуя. Используя тяжелую воду можно заварить себе чаю, например. Правда постоянно ее пить нельзя, но с радиоактивностью это никак не связано, в тяжелой воде химические реакции идут чуть медленнее чем в обычной и для организма это критично.
>>409903
Вода очень плохой пример, потому что радиоактивной ее сделать практически невозможно. Для этого нужны термоядерные реакции с неебической энергией.
Аноним 14/04/17 Птн 23:09:17  409966
>>409964
>Вода очень плохой пример
Ок, тогда металл
Аноним 14/04/17 Птн 23:22:46  409968
>>409903
под воздействием внешних источников, ядро переходит в возбужденное состояние - т.е. в нестабильную конфигурацию с конечным временем жизни, затем происходит переход в стабильное с испусканием частиц или гамма кванта. Короче, если ты знаешь, как испускается излучение атома, как квантуется атом водорода, то здесь все то же самое, только все процессы происходят в ядре и соответственно мы имеем дело с другими энергиями.
Аноним 14/04/17 Птн 23:38:31  409970
>>409777
Спасибо, анон.
Аноним 15/04/17 Суб 18:20:25  410005
Имеется покоящийся диполь, тогда по теореме Гаусса поток через сферическую поверхность окружающую диполь равен нулю, а следовательно и напряженность равна нулю. Где обосрался?
Аноним 15/04/17 Суб 18:41:15  410006
почему sci такая дохлая борда?
Аноним 15/04/17 Суб 18:46:39  410007
>>410005
Дело в симметрии, да?
Аноним 15/04/17 Суб 19:22:34  410011
>>410005
Поток нулевой, но сферической симметрии нет, т. к. есть выделенное направление (ось диполя). Цилиндрической/плоской симметрии тоже нет. Закон Гаусса не обязательно удобен или полезен.
Аноним 15/04/17 Суб 19:29:12  410012
lol.PNG (244Кб, 491x282)
Не могу врубиться . как ?
Аноним 16/04/17 Вск 01:42:13  410027
Откуда объекты во вселенной приобрели вращение? Почему Земля вращается вокруг Солнца, почему Солнце вращается вокруг центра галактики. Где все тела приобрели импульс?
Аноним 16/04/17 Вск 02:58:14  410032
benis.jpg (7Кб, 161x220)
Школьник не слишком умный, но стремящийся врывается в тред.

Недавно у хохлов нашёл интересную олимпиадную задачку предназначенную для 1-2 курсов по физике, перевод которой излагаю ниже.

"Изобретатель утверждает, что ему удается получить отрицательное электрическое сопротивление. Он говорит:

"Рассмотрим вертикальный конус, который находится между пластинами-проводниками, одна из которых касается основы конуса, а вторая - его вершины. Этот конус имеет сопротивление R. Его можно рассматривать как последовательно соединенные сопротивления: верхняя и нижняя части конуса. Верхняя часть - это также конус вдвое меньшей высоты, подобный исходному. Нетрудно доказать, что его сопротивление равняется 2R (это верно для любых подобных тел, которые имеют размеры вдвое меньшие). Поэтому сопротивление нижней части исходного конуса равняется R - 2R = -R, то есть нижняя часть конуса имеет отрицательное сопротивление."

Прав ли изобретатель?"

Собственно, я попытался рассмотреть конус как набор бесконечно тонких блинов и проинтегрировать всю эту хуйню, но ожидаемо наткнулся на абсурдные бесконечные значения и расходящийся интеграл. И правда - в похожих, пусть и численных задачах, конус всегда рассматривается в усечённом виде, чтобы избежать ухода значений сопротивления вершины в бесконечность, здесь же конус дан именно неусечённый.

Значит, здесь играет роль условие того, что конус находится между пластинами. Как это учесть и что из этого выйдет?
Аноним 16/04/17 Вск 03:22:42  410034
apocalypto-5063[...].jpg (329Кб, 1200x765)
>>410027
>Откуда объекты во вселенной приобрели вращение? Почему Земля вращается вокруг Солнца, почему Солнце вращается вокруг центра галактики. Где все тела приобрели импульс?
В моём представлении это изначальные движения вселенной, ускорившиеся за бесконечно долгое время из абсолютной изотропии до подобных скоростей.
просто из-за того что изначальное dx -> 0, и d2x -> 0, и d3x -> 0, но этот ряд производных был бесконечным и время было бесконечным, в итоге получаем уже вполне себе конечные величины, которые только увеличиваются, но мы этого не замечаем, потому что вращаемся во всём этом сами, уменьшаясь относительно расстояний между центрами вращения (потому что там ещё dy и dz) что создаёт иллюзию сохранения в том числе и импульса. это следует из того, что ничто - единственное нечто, к которому не применим вопрос "на а это откуда взялось?" если мы говорим о возникновении всего. а выше описан процесс появления чего-либо из ничего (если ты в состоянии воспринять такие понятия как бесконечность и бесконечномалое)
Вот эти ребята к тем же самым выводам по другим тропинкам пришли ещё в 70х, как я понял: https://www.youtube.com/watch?v=97fNgK8gZRs
Аноним 16/04/17 Вск 07:10:21  410036
>>410032
Скорее всего, ты не там ищешь. Где-то в условии софистика закралась.
Общее сопротивление конуса R. Но сопротивление в месте сечения не 2R, а 2R0 - удвоенное сопротивление на основании конуса. Они не равны, ведь у нас не цилиндр.
Так что изобретатель со своей логикой обосрался, похоже. Хорошо хоть не вечный двигатель притащил.
Аноним 16/04/17 Вск 10:40:26  410042
>>410027
>Почему Земля вращается вокруг Солнца
Гравитация
>почему Солнце вращается вокруг центра галактики.
Хуй знает
>Где все тела приобрели импульс?
Большой взрыв же
Аноним 16/04/17 Вск 11:33:01  410045
1491599339.jpg (123Кб, 498x600)
>>410036
Да слова изобретателя даже опровергать не нужно - очевидная хуита.
Я у оргов олимпиады интересовался - они сказали, что предполагалось, что ты посчитаешь реальное соотношение сопротивлений и опровергнешь изобретателя таким образом, а не просто скажешь "изобретатель долбоёб".
Я вот и попытался посчитать, в результате чего обосрался и получил бесконечное сопротивление.
Тогда переформулирую задачу на гораздо более простую:
Как посчитать сопротивление конуса, заданного параметрами R, H и удельного сопротивления p, зажатого между двумя проводящими условно бесконечными пластинами?
Аноним 16/04/17 Вск 11:55:05  410047
>>410032
> Нетрудно доказать, что его сопротивление равняется 2R (это верно для любых подобных тел, которые имеют размеры вдвое меньшие)
А что с проволкой это не работает?
Аноним 16/04/17 Вск 11:56:08  410048
>>410045
Я предлагаю так: раз с обычным конусом не получается, то делай с усечённым. Чтобы данная мат. модель не сильно расходилась с реальностью, нужно обрезать очень мало. Думаю, 1/200 от общего объёма. Считаешь, получаешь примерный результат. Это же физика , а не математика, 100% точности не бывает даже в задачах. Сам я этого делать, конечно, не буду.
Аноним 16/04/17 Вск 11:59:27  410050
>>410047
Нет: проволока - это цилиндр, длина уменьшилась в 2 раза, площадь константа. Формула R=рl/S. Получаем, что сопротивление упало в два раза.
Аноним 16/04/17 Вск 12:01:07  410051
>>410050
ну так почему с конусом должно работать?
Аноним 16/04/17 Вск 12:23:16  410052
>>410051
upd работает.
Аноним 16/04/17 Вск 12:23:44  410053
14204999368720.png (18Кб, 200x131)
>>409968
>если ты знаешь как квантуется атом водорода
конечно, я же каждый день квантую водород, какие тут проблемы?
Аноним 16/04/17 Вск 12:36:11  410054
>>410047
Так если разрезать проволоку пополам - то уменьшится только длина в 2 раза, а площадь поперечного сечения останется неизменной. А если обрезать конус - то длина уменьшится в 2 раза, а площадь - в 4.
Аноним 16/04/17 Вск 13:14:00  410056
Что лучше для работы: чтоб мозг был под постоянным напряжением, например, чтоб ты ходил задом вперед и решал какие-то задачки или чтоб ты сидел, тебя ничего не отвлекало и ты также решал какие-то задачки?
Аноним 16/04/17 Вск 13:29:40  410057
>>410056
я дрочу задом наперед . говорят помогает
Аноним 16/04/17 Вск 15:52:32  410061
>>409841
Ну, рекурсия в этом задействована не последним образом.
Аноним 16/04/17 Вск 16:14:46  410064
>>409550 (OP)
Подскажите есть ли ресурс со всеми (хотя бы до начала 21 века) математическими доказательствами на русском языке?
Аноним 16/04/17 Вск 17:04:43  410068
>>410064
Одна только вавилонская библиотека, и то возможны нюансы. А тебе зачем?
Аноним 16/04/17 Вск 19:08:26  410078
>>410068
Подразумевался стандартный и наглядный ресурс. Нужен для разработки и изучения. Жаль, что нет, а по пути Бурбаки идти не хочется.
Аноним 16/04/17 Вск 19:36:28  410080
>>410078
Поставь себе экспертные системы, и системы логического вывода, проги для автоматического доказательства теорем, и coq.
И там потом автоматизируй эти свои доказательства через GPU, ASIC и FPGA, и ещё быстро и даже в динамике.
Аноним 16/04/17 Вск 19:43:26  410082
С какого хуя что-то может существовать?
Аноним 16/04/17 Вск 21:24:43  410089
14904050237540.jpg (128Кб, 800x450)
>>410048
Хорошо, спасибо. Попробую так доказать. А у оргов олимпиады тупо нет решения, как оказалось, лел.
Аноним 16/04/17 Вск 23:11:43  410093
>>410080
Благодарю за наводку, извращенец.
Аноним 16/04/17 Вск 23:33:43  410095
>>409550 (OP)
У чистого урана-238 есть критическая масса?
Аноним 17/04/17 Пнд 07:13:17  410108
как по давлению в шинах определить температуру воздуха? зимой компутер пишет 2.9, норм это 3.3 а летом доходит до 4. хотя накачаны одинаково.
Аноним 17/04/17 Пнд 09:53:00  410111
>>410082
с божественного, конечно же
Аноним 17/04/17 Пнд 09:54:29  410112
>>410056
Для чьей работы?
У каждого по-своему, все зависит от множества персональных факторов.
Мозгу насрать, он и так и так адаптируется.
А вообще самый опитмальный ответ и вариант-динамика, ибо стимуляция распологает.
Аноним 17/04/17 Пнд 11:11:41  410114
>>409550 (OP)

Слушайте, есть два предмета с разной массой, но с одинаковой формой. Я считаю, что предмет, который тяжелее упадет раньше, чем легкий. Разрешите Плес(предметы НЕ в вакууме)
Аноним 17/04/17 Пнд 11:12:35  410115
>>410042
Причем тут гравитация. Если ты объект поместишь на земную или солнечную орбиту без какой либо скорости он просто упадет на землю/солнце. А я интересуюсь источником этой скорости. Когда мы запускаем спутники им придают ускорение для выхода на орбиту. И мой главный вопрос кто придал ускорение веществу из которого образовалась земля да и все звезды в галактиках.
Аноним 17/04/17 Пнд 11:45:44  410116
>>409759

Короче, есть длинная закрученная хуйня, на которой выступают разные органические соединения атомов.Затем по этой закрученной хуйне двигается рыбосома, которая засасывает в себя эти соединения атомов(АА ГГ УЦ ТЦ и т.д.) и последовательно соединяя эти атомы внутри себя высирает полноценные белковые цепи, которые затем выходят из области ядра клетки и направляются куда надо.
Аноним 17/04/17 Пнд 11:56:05  410117
>>410114
Сопротивление среды никто не отменял.
Аноним 17/04/17 Пнд 12:26:05  410120
>>410115
>Если ты объект поместишь на земную или солнечную орбиту без какой либо скорости он просто упадет на землю/солнце.
Проиграл.
Аноним 17/04/17 Пнд 16:56:07  410153
>>410115
>И мой главный вопрос кто придал ускорение веществу из которого образовалась земля да и все звезды в галактиках.
Астрономы и физики утверждают, что всё началось с одного большого взрыва.
Аноним 17/04/17 Пнд 17:15:50  410156
>>409849
Возможно тот анон хочет понять почему природа решила что именно АА ГГ ЦЦА - аминокислота "анальная смазка". А если ГГ АА ЦЦА то это будет аминокислота "вонь селедочная".
Аноним 17/04/17 Пнд 18:52:22  410170
Что будет если землю с луной сцепить cупер прочным металлическим прутом? Они будут вместе двигаться?
Аноним 17/04/17 Пнд 20:40:44  410177
>>410170
Прут поламается
Аноним 17/04/17 Пнд 21:17:19  410187
Как с научной точки зрения объяснить что мне хочется дергать письку?
Аноним 17/04/17 Пнд 21:50:20  410190
>>410153
сегодня такое даже хокинг уже не утверждает
ещё один повод ужаснуться уровню российского образования
Аноним 17/04/17 Пнд 21:54:11  410192
>>410187
не уверен на счёт сугубо научной точки зрения, потому объясню со своей:
Если бы размножение не подкреплялось положительными эмоциями, мы бы уже вымерли (потому остались лишь те, у кого подкреплялось)
Учитывая что где-то там мы с самками скреплялись во времена нашей одноклеточности, ничего удивительного что там так чувствительно всё, центр естества в определённой степени даже.
Аноним 18/04/17 Втр 01:42:27  410205
>>410177
допустим он бесконечной прочности (отрицательной точнее, т.е минус бесконечность)
Аноним 18/04/17 Втр 01:45:43  410206
>>409550 (OP)
Поясните, где в ландафшице искать теорию дебая-хюккеля. Интересует экранирование кулоновского потенциала. 78 параграф штоле?
Аноним 18/04/17 Втр 03:58:47  410207
Чтобы было бы на земле, если бы гравитация зависела от температуры и ее бы передавали в прогнозе погоды.
Аноним 18/04/17 Втр 05:24:48  410209
515[1].jpg (15Кб, 944x334)
516[1].jpg (17Кб, 923x400)
280px-BetaNegat[...].png (9Кб, 280x280)
>>409964
>Дейтерий же не радиоактивный нихуя. Используя тяжелую воду можно заварить себе чаю, например.
Пик1 - протон-протонный синтез.
Пик2 - позитрон, ядро дейтерия и электронное нейтрино.
В ядре дейтерия - протон и нейтрон.
Пик3 - диаграмма Фейнмана процесса распада нейтрона в протон.
На входе - нейтрон, на выходе - протон и W--бозон, который распадается в электрон и электронное антинейтрино.
По-сути, если нейтрон в ядре дейтерия распадается в протон - образуется тепловой протон и бета-частица,
которые в толще дейтерия - могут быть поглощены и объединиться в один атом водорода.
Аноним 18/04/17 Втр 05:53:30  410211
>>410207
Были бы иначе устроены звёзды и планеты. Об инженерных приложениях трудно судить, не представляя себе интенсивности и характера зависимости, но как минимум один лишний сорт охуительных электростанций на дармовой энергии у нас бы был.
Аноним 18/04/17 Втр 07:49:45  410212
>>410190
И что он вместо этого утверждает, умник?
Аноним 18/04/17 Втр 08:46:06  410216

>>410212
Бог создал.

В описанной выше модели горячего Большого Взрыва на ранних стадиях развития Вселенной не имеется периода времени, достаточного для передачи тепла от одной области к другой. Это означает, что различные области Вселенной должны были иметь абсолютно одинаковую начальную температуру, чтобы это согласовалось с тем фактом, что температура фонового микроволнового излучения одинакова во всех направлениях, куда бы мы ни посмотрели. Кроме того, начальная скорость расширения должна была выбираться с большой точностью, чтобы Вселенная не схлопнулась к настоящему моменту. Следовательно, начальное состояние
Вселенной в самом деле должно быть выбрано крайне тщательно, если модель горячего Большого Взрыва справедлива на отрезке от нынешнего момента и вплоть до самого начала времени. Почему Вселенная зародилась именно так, очень трудно объяснить чем-либо иным, кроме воли Бога, который намеревался сотворить существ, подобных нам.
Аноним 18/04/17 Втр 09:01:05  410218
>>410216
И это Хокинг утверждает? Линк на источник, милейший.
Аноним 18/04/17 Втр 09:07:17  410219
>>410216
Типа матрица?
Аноним 18/04/17 Втр 09:33:47  410220
>>410187
Сексуальные стимулы => электрические и биохимические процессы в теле (с помощью нейромедиаторов норадреналина, ацетилхолина и окситоцина сигналы передаются к гладкой мускулатуре пещеристых тел, половой член наполняется кровью) => половое возбуждение => мастурбация.

Аноним 18/04/17 Втр 09:42:11  410221
>>410220
Забыл добавить. Этот алгоритм работает потому, что ты запрагроммирован на размножение. Это инстинкт.
Аноним 18/04/17 Втр 09:43:42  410222
>>410218
Хокинг С. и др.
X 70 Теория всего. Происхождение и судьба Вселенной / Стивен Хокинг; [пер.
с англ. И. Иванова; под ред. Г. Бурбы]. — СПб.: Амфора. ТИД Амфора, 2009. —148 с.
ISBN 978-5-367-00991-0 (рус.)
ISBN 1-59777-554-1 (англ.)
Аноним 18/04/17 Втр 09:46:00  410223
>>410222
Чавой-та Хокинг так троллить стал? Стэндап скоро будет? Ах да, он ж колясочник)).
Аноним 18/04/17 Втр 09:46:08  410224
>>410221
>инстинкт
Никогда не пользуйся этим словом. Умнее казаться будешь.
Аноним 18/04/17 Втр 09:48:07  410225
>>410224
Авторитетное мнение авторитетного человека.
Аноним 18/04/17 Втр 09:51:17  410226
>>410225
НИКОГДА
Аноним 18/04/17 Втр 09:54:04  410227
>>410226
Инстинкт.
Аноним 18/04/17 Втр 10:19:53  410228
>>410227
Глаза умные, но вот говоришь как дурак.
Аноним 18/04/17 Втр 11:48:31  410235
Из чего состоит нейтрино, если на него и фотоны распадается электрон при термоядерном?
Аноним 18/04/17 Втр 12:56:08  410236
>>410235
Из эфира, только никому не говори.
Аноним 18/04/17 Втр 13:04:14  410237
>>410235
Все вещества вселенной состоят из электроатомов Всеродов
Аноним 18/04/17 Втр 13:27:05  410238
>>410236
>>410237
Уроки сделал?
Аноним 18/04/17 Втр 13:38:10  410239
Анон у меня такой пожар начинается когда я встречаю адептов катищука и прочих козлов. что мне с этим делать?

это мой тупой вопрос
Аноним 18/04/17 Втр 13:43:30  410240
>>410239
сделать уроки, например.
Аноним 18/04/17 Втр 13:47:06  410241
>>410240
мне 25 лет
Аноним 18/04/17 Втр 13:48:14  410242
>>410241
Тогда странно, что у тебя полыхает от больных.
Аноним 18/04/17 Втр 13:56:46  410243
>>410242
наверное единственный способ успокоиться, отпиздить достаточным количеством аргументов одного из больных.
Аноним 18/04/17 Втр 13:59:09  410244
>>410243
>достаточным количеством аргументов
Wrong.
Не поможет - только ногами.
Аноним 18/04/17 Втр 14:10:09  410247
>>409550 (OP)
Случаи сталкивания чёрных дыр достоверно известны. А известны ли случаи раздвоения чёрных дыр?
Аноним 18/04/17 Втр 14:30:02  410249
>>410238
В школьных учебниках сейчас пишут про эфир? Даже в универских учебниках его избегают упоминать, опасаясь, что студент начнет думать.
Аноним 18/04/17 Втр 14:30:53  410250
>>410247
>раздвоения чёрных дыр
Чо? Дыра в пространстве может делится?
Аноним 18/04/17 Втр 14:31:56  410251
>>410249
Везде про это пишут, когда речь заходит об опытах майкельсона-морли.
Аноним 18/04/17 Втр 14:32:36  410252
>>410239
>пожар начинается
Это от треска манямирка.
>что мне с этим делать?
Надо выйти из манямирка и начать жить в реальности.
Аноним 18/04/17 Втр 14:33:35  410253
Чет нихуя не понял. Эфир - это свет?
Аноним 18/04/17 Втр 14:33:47  410254
>>410235
у вас неправильное представление о распадах в физике фундаментальных взаимодействий, там не проходит простая механическая интерпретация распада.
Аноним 18/04/17 Втр 14:34:50  410255
>>410251
Ну там совсем мало. Человек не успевает понять где его наебали.
Аноним 18/04/17 Втр 14:35:36  410256
>>410255
хотя бы то осиль.
Аноним 18/04/17 Втр 14:36:08  410257
>>410253
Эфир это практически синоним материи. В частности - это материя вакуума.
Аноним 18/04/17 Втр 14:37:33  410258
>>410250
В том и вопрос. Да, как клетка, например. Это бред, такого не может быть?
Аноним 18/04/17 Втр 14:38:16  410259
>>410257
Это типа материя, которая находится в материи пространства?
Аноним 18/04/17 Втр 14:42:30  410260
>>410259
Не. Это материя. Материя она по умолчанию уже в пространстве, по определению. Из материи состоит всё - протоны, фотоны, всякие поля, вакуум.
Аноним 18/04/17 Втр 15:02:59  410262
Говоря "эфира нет", моченые отказываются от материи, т.е. от основного предмета изучения физики, а значит от самой физики отказываются. Вот так вот.
Аноним 18/04/17 Втр 15:31:59  410263
LNV1QX5KtBY.jpg (151Кб, 1280x720)
Всем привет, с вами снова глупый школьник! Намедни попытался ещё раз понять, что за хуйня происходит в СТО, но так и не смог. Надеюсь на вашу помощь.

1. Измение массы в СТО реально или это какой-то ебучий костыль? Слышал когда-то, что понятие "изменения массы" уже устарело. Так ли это и если да - то что пришло ему на смену?
2. Что в СТО подразумевается под "изменением %параметр_нейм% относительно инерциальной системы отсчёта"?
Допустим, я стою и мимо меня пролетает огромных размеров член на околосветовой скорости. "Изменение его размеров" будет означать, что его длина уменьшится в моём личном восприятии (т.е. я буду видеть его более коротким, чем он есть в состоянии покоя) или его длина будет изменяться как-то вообще?
А если этот же член залетает в мамашу ОПа - почувствует ли она сокращение его размеров? Как изменение длины летящего члена выражается в изменении его взаимодействия с покоящимися телами?
3. Есть ли популярное обьяснение "парадокса близнецов"? На вики одна малопонятная хуйня, гугление тоже ничего адекватного не дало. Ну или я просто слишком тупой.
Аноним 18/04/17 Втр 15:37:10  410266
Понимаю, что вопросами про теорию относительности вас уже заебали, но СТО и ОТО - это первый реальный барьер в изучении физики, который вынуждает воспринимать её совершенно иначе, в отрыве от привычных ассоциативных представлений.
Аноним 18/04/17 Втр 15:56:49  410268
Не знаю где спросить. Посоветуйте книгу по психофизике.
Аноним 18/04/17 Втр 16:39:50  410270
почему взрослые косят под школьников? анонимный же форум
Аноним 18/04/17 Втр 16:43:19  410272
>>410270
Не хотят, чтобы их посчитали за даунов.
Аноним 18/04/17 Втр 17:35:33  410277
>>410263
1. не слышал ничего об устаревании этого понятия
2. именно это и подразумевается. ты стоишь, хуй летит. его длинна в твоем личном восприятии будет короче, чем он есть на самом деле. допустим вот хуй 8======D. если он будет стоять недалеко от тебя, ты будешь видеть его таким 8======D. если он будет лететь с коколо световой число = будет уменьшатся, т.к. свет от 8 будет прилетать до тебя примерно тогда же, когда и от D. чем хуй летит быстрее, тем меньше = ты увидишь. можешь считать что от соседних = свет будет долетать до тебя одновременно, поэтому ты будешь думать что соседние = это одно и то же =.
3. я не знаю чего там можно не понять. хочешь узнать кто постареет на самом деле? тот кто фактически менял свою скорость(классическая задача - один опездол полетел к далекой пизде, второй остался на земле. тот который полетел, через какое то время долетел таки, развернулся, прилетел обратно.) вот тот опездол, который летал, ускорялся, замедлялся, дальше летал - он моложе. почему? потому что преобразования лоренца. популярнее это обьяснить я хз как.

Аноним 18/04/17 Втр 17:45:10  410279
>>410253
нет, эфир это не свет. точно так же можно сказать - нихуя не понял, звук это вода? звук - есть колебания чего то, какой то среды. например воды. или воздуха. таким же раком моченые задумались - вот звук это колебания, а свет тоже колебания. звук это колебания молекул той же воды. а свет это колебания чего? по-любому ведь есть какая-то ебень, которая колеблется. допустим колеблется некая йоба-ебень. назовем-ка эту йоба-ебень эфиром. не важно что мы её нихуя не видим, воздух вон тоже не видим. или не видели(на случай вскудахтов что можно видеть марево там). но потом ведь увидели воздух. так так так, воздух значится, хуе-моё, у него есть ветер. подожди ёбана, значит и у эфира может быть ветер и прочие свойства такого вот недовоздуха. все это значится предположили. и потом стали искать эти самые ветра, пускаемые эфиром. например опыт мейкельсона -морли или как он там. провели его значится, никаких ветров не обнаружили, сказали нет никакого зефира, нехуй тут нести хуйню. а свет это видимая часть электомагнитных колебаний. как-то так. потом правда сделали еще 100500 опытов, с большей точностью и прочей еботой. и вроде даже какие то ветра обнаружили. или не обнаружили. тут на этих фактах пол сосача скачет что эфир есть, но что это такое скачущие не знают.
Аноним 18/04/17 Втр 17:46:48  410280
>>410239
>что мне с этим делать
Изучать знания РУСов, коренного населения Земли
https://www.youtube.com/watch?v=-4pm4AXQ9uM
Аноним 18/04/17 Втр 17:48:03  410281
>>410253
Нет никакого эфира, есть лишь электроатом ВсеРОД
Аноним 18/04/17 Втр 17:50:57  410282
>>410277
>8======D
Он как пистолет.
(•)=ε//’’ ””


На ещё:
(. Y .) ( .Y. ) (・∀・) (• | •) (• Y •) C===3 8===D 8===Э Є===3 .!. ∩ ∩(_0_)
Аноним 18/04/17 Втр 17:52:17  410283
blob (166Кб, 320x297)
>>410280
каждый раз с этого омича проигрываю
Аноним 18/04/17 Втр 18:30:02  410284
Посоветуйте материалы по голографии, но ориентированны на случай с небольшим пониманием математики и физики.
Аноним 18/04/17 Втр 18:52:24  410289
>>410277
>хочешь узнать кто постареет на самом деле?
Если один близнец ускорялся до 0.999c за короткое время, допустим четыре дня общего ускорения, по одному дню на маневр ускорения или торможения, но при этом он летел в свободном состоянии длительное время, 20 лет в одну сторону и 20 лет в обратную сторону, кто из близнецов постареет, если ускорение было ничтожное время, а равномерное движение длительное время?
Аноним 18/04/17 Втр 19:02:35  410291
>>410289
я же написал - тот который летал, ускорялся, замедлялся и т.д. я не писал сколько времени он этим занимался. главное сам манёвр. он был? был. сманяврировал - не постарел, лiл))
Аноним 18/04/17 Втр 19:18:19  410295
1J8NgNp797s.jpg (151Кб, 974x553)
>>410270
Если хочешь - могу пруфануть свои удостоверения глупого школьника, мне не жалко. У меня их много, я школьник активный.
>>410277
Хорошо, спасибо. Теперь всё более-менее понятно. Только во 2 пункте ещё непонятна такая вещь:
> А если этот же член залетает в мамашу ОПа - почувствует ли она релятивистское сокращение его размеров? Или она почувствует, что ей в попец вошёл полноразмерный член? Как изменение длины летящего члена выражается в изменении его непосредственного взаимодействия с покоящимися телами?
Аноним 18/04/17 Втр 20:19:00  410304
hawking and pop[...].png (199Кб, 766x179)
>>410223
Он всегда так "троллил", но ты его не читал (и не надо) - в краткой истории времени бог упоминается более полуторы сотни раз (а сама идея биг б-га придумана христианским священником)
а ты думал физиков replication crisis не касается? хуесосов рассматривающих науку как непыльную работёнку с доступом к студенточкам во всех областях большинство, по ряду причин
Аноним 18/04/17 Втр 22:00:56  410312
>>410291
>сманяврировал - не постарел, лiл))
Вся суть сто - парадоксальные маняврирования.
Аноним 18/04/17 Втр 22:04:10  410313
>>410284
википедия
Аноним 18/04/17 Втр 22:29:33  410316
ДВАЧ у меня паника ! я запутался . Бляяяяяяяяяяя

я одну тему прохожу один день .

СУАА ЧЕ ДЕЛАТЬ
Аноним 19/04/17 Срд 08:28:30  410348
>>410312
точно так же можно и про математику первого класса сказать, особенно какому-нить неандертальцу
Аноним 19/04/17 Срд 08:29:10  410349
blob (409Кб, 604x448)
>>410316
трахни своего кота
Аноним 19/04/17 Срд 09:09:46  410352
Зашел в /b и охуел. Эти дауны приравнивают свет к току, думают что искра - это не ионы и наконец, они думают, что свет = радио, хотя по свойствам они пиздец как отличаются. Это все равно, что приравнять кошку к Солнцу. А че, они де оба массовые)))
Аноним 19/04/17 Срд 09:18:50  410355
блят дак первично сознание или материя?
Аноним 19/04/17 Срд 10:22:53  410356
>>410355
Проведи эксперемент.
Умри. Затем попадешь к богу-ам или к высшей расе(выйдешь из матрицы в 4777723434кккккккк году где люди развлекаются запуская своих аватров в прошлые вселенские циклы)-тогда сознание.
Ничего не будет. Ну тогда, гкхм. Похуй?

Да и материя ебет сознание. сознание ебет материю. Не всле ли равно с какой стороны смотреть на этот инь-янь, эдакий уроборос?

Аноним 19/04/17 Срд 10:40:32  410358
>>410356
>ебет
>ебет
Девушку себе найди, девственная омежка.
Аноним 19/04/17 Срд 10:47:08  410360
>>410358
Тяжело, и ты спутал меня с типичным архетипом сосача.
Аноним 19/04/17 Срд 11:11:46  410361
>>410295
>почувствует ли она релятивистское сокращение его размеров?
как в моей пасте выше про 8====D, с её ощущениями будет происходить то же самое. с некоторыми оговорочками.
оговорочка 1 - в пасте выше ты видел два разных = как одно, потому что свет от них доходил до тебя одновременно. а у мамаши опа, как и у всех остальных людей, ощущения чего либо наступают только после того, как электрический сигнал от синапсов на пезде через все тело дойдет до моска. причем идти будет не прямолинейно как свет от = до глаза, а по сети нейронов. т.е. тупо из-за скорости доставки сингала до мозга почувствует сокращение.
оговорочка 2. человек так устроен, что процессы, быстрее некоторого интервала времени ваще не замечает. я не биолог и точного интервала времени не помню(в школе или где то еще слышал про него инфу, поэтому именно не помню, а не знаю). допустим этот интервал 1 секунда(на самом деле типа 300 мс чтоле, для примера пусть будет секунда). события, которое будет происходить меньше чем за секунду для человека просто не будет. как для него нет дискретных взмахов крыльев шмеле в полете, а тупо нечно размазанное. т.е. если хуй такой влетит и вылетит меньше чем за секунду, то она ваще не почувствует самого вхождения, хотя анал потом будет болеть.
это было о человеческих ощущениях.
теперь о реальном взаимодействии. летит такой дилдак 8=========D (9 знаков =). допустим летит с такой скоростью, что глазками мы видим его как 8=D. так же, предположим что дилдак может за пренебрежимо короткое время поменять направление своего движения на противоположное.
итак, влетел он в мамку, видимый как 8=D, и вылетел обратно, съебавшись восвояси. а мамка осталась проткнутой насквозь, потому что он не сжимался, до 8=D. это ты его видел как 8=D, да и то, только потому, что свет от соседних = долетал до тебя одновременно.
это как если пулю в лоб кому нить пустить, он звук выстрела не услышит, потому что пуля долетит до лба быстрее звука от выстрела. но при этом, этот факт не значит, что пули нет. как то так.
Аноним 19/04/17 Срд 11:37:14  410364
>>410352
>свет = радио, хотя по свойствам они пиздец как отличаются
Можно подробнее осветить эту тему?
Аноним 19/04/17 Срд 11:41:37  410365
>>410352
Двач состоит на 85% минимум из людей пубертанного возраста. Им всем около 12 лет. Это ещё дети, тупые и агрессивные, с желанием казаться старше, чем они есть, но дети.
Аноним 19/04/17 Срд 11:44:49  410367
Вопрос про расширение вселенной. Если расширяется само пространство, то почему это проявляется только на уровне галактик, т.е. расстояния между галактиками увеличиваются, а между звездами в галактике нет. Их удерживает сила гравитации? Тогда получает, что эту силу, которая расширяет пространство можно измерить? Если 2 галактики зафиксировать относительно друг друга, ну тип палку между ними кинуть))) то тогда пространство будет двигаться относительно этих галактик? Это можно будет зафиксировать?
Аноним 19/04/17 Срд 11:49:08  410368
SFERO4KA.png (36Кб, 1280x800)
Анон, объясни эту хуйню: есть две металлические сферы, одна заряжена, другая нет. Но внутри незаряженой есть один маленький но удаленький зарядик. Так в чем вопрос, в каких областях (1-снаружи шаров, 2-в самом материале шара. 3-внутри, в полой части) в первом и втором случаях будет существовать электрическое поле?
Аноним 19/04/17 Срд 11:55:01  410369
>>410364
светом, или радио?
Аноним 19/04/17 Срд 12:17:24  410372
>>410368
случай заряженной сферы.
облясть iii без эл поля.
облясть ii с полем наверн, смотря как размазан по ней заряд.
облясть i с полем.
случай заряда внутри сферы.
поле есть везде. да еще и сфера твоя покроется изнутрей отрицательными зарядами(их притянет положительный внутрях сферы), а снаруже положительными(обиженки, оставшиеся без притянутых отрицательных на нутрях).

проходят сие в школах и даже есть учебник гиде сие рассматриваеся
Аноним 19/04/17 Срд 12:21:40  410373
>>410252
>Это от треска манямирка
скорее от феноменальной отбитости.
Я просто только недавно впервые почитал комменты на ютюбе.
>начать жить в реальности
>поменять один манямир на другой
вот так правильнее
Аноним 19/04/17 Срд 12:22:49  410374
>>410280
бля уже успел похуеватъ от его ВСЕРОДА
Аноним 19/04/17 Срд 13:29:07  410375
>>410374
кто такой, чем знаменит?не выдерживаю более 5 минут бреда собачьего этого рыбникова, посему не слыхал даже о ВСЕРОДЕ
Аноним 19/04/17 Срд 13:34:23  410376
>>410375
загуглил. обосрался на ВЕСЬ ОФИС
Единичный электроатом Всерод 0/0-РУС1, гамма электрочастица, Электронейтрален, Первоэлектроатом Вселенной, может иметь любые размеры, кроме НОЛЯ, имеет минимальную электрическую объёмную плотность во всех взаимодействиях. - это ведь клиника, такое надо карательной психиатрией лечить.
Аноним 19/04/17 Срд 13:58:38  410378
Почему в наблюдаемой части вселенной в настоящее время отсутствует термодинамическое равновесие?
Аноним 19/04/17 Срд 14:01:07  410379
>>410378
а почему оно должно присутствовать?
Аноним 19/04/17 Срд 14:09:16  410380
>>410280
В этом видео даются основы счета древних РУСов?
https://youtu.be/FLzEJy3n7HM?t=14m50s
Аноним 19/04/17 Срд 14:53:59  410381
>>410380
осьмушка и хуй на воротникушка? да, именно они - ОСНОВЫ РУСов
Аноним 19/04/17 Срд 16:15:36  410385
Зачем конспектировать если есть справочник и учебники по типу == <<предмет нэйм>> в схемах и табилицах ?
Аноним 19/04/17 Срд 16:19:11  410387
>>410385
вася сидел и конспектировал. петя читал справочник и учебник. вася лучше запомнил то, что проходили, потому что больше с этой еботой ебался. а отчислили их обоих. этим петей был альберт эйнштейн.
Аноним 19/04/17 Срд 17:58:59  410398
Если у мня Синдром дефицита внимания на егэ всерано придется пиздовать ?
Аноним 19/04/17 Срд 18:25:11  410399
>>410398
можешь не пиздовать. мусора компенсируют весь твой дефицит когда будешь где нить бомжевать. а потом и на бутыль усадят. хотя не, весь дефицит еще в армейке отобьют
Аноним 19/04/17 Срд 18:54:47  410401
Кто нить мне объяснит сфигали в ядерной реакции с бетараспадом, при бета излучении (не захвате), меняется количество протонов в атоме. Неужели электронное поле как то влияет на кварки?
Аноним 19/04/17 Срд 19:42:49  410405
310px-BetaNegat[...].png (11Кб, 310x310)
>>410401
Аноним 19/04/17 Срд 19:48:39  410406
>>410401
И да, не электронное поле, а электрослабое взаимодействие.
Аноним 19/04/17 Срд 20:00:45  410407
>>410405
Не эта то понятна, я имею ввиду куда девается электрон с внешней оболочки, или сегда получаются ионы?
Аноним 19/04/17 Срд 20:49:31  410413
>>410407
он и не задерживается там, энергии другого порядка.
Аноним 19/04/17 Срд 21:55:24  410419
1492627464966[1[...].webm (816Кб, 352x240, 00:00:31)
1492625831290[1].gif (3665Кб, 445x250)
какова максимальная скорость и вес чтобы выжить? дайте формулу расчета.
первому кажется повезло меньше чем второму. почему?
Аноним 19/04/17 Срд 22:17:57  410422
fiz10-11p4-93[1].jpg (10Кб, 576x130)
t36[1].png (15Кб, 708x147)
as-and-alevel-p[...].jpg (96Кб, 638x479)
>>410419
Зависит от энергии, которая изменяется при изменении импульса и передаётся при ударе.
Алсо, p = mv; где p - импульс, m - масса, v - скорость.
Ek = mv2/2 = pv/2; где Ek - кинетическая энергия тела, m - масса, v - скорость.
Аноним 19/04/17 Срд 22:31:20  410423
>>410422
я не могу понять как посчитать с какой скоростью должен двигаться автомобиль, чтобы оторвавшееся колесо могло убить. нужно учесть вес колеса. а что еще? как посчитать скорость скачащего колеса? с какой силой оно должно ударить по репе чтобы прикончить?
Аноним 19/04/17 Срд 22:41:02  410424
>>410423
Даже не начинай, это бесполезно. Травмы это гидродинамика, а гидродинамика это шаманизм.

Первому чуваку прилетело точнёхонько под затылок, так что он, вероятно, жив, но парализован ниже шеи.
Аноним 19/04/17 Срд 23:07:06  410428
>>410423
Там это колесо ещё и с горы прилетело.
Через кинетическую энергию считать и импульс, рассматривая колесо как материальную точку.
Ведь весь удар приходится именно на место соприкосновения колеса телом, об которое оно ударяется.
Там контакт, и энергия передаётся, и импульс.
Дальше, смотришь куда оно бьёт, и ну...
Если в шею, то там не так уж много надо, чтобы позвонки сломать и хрящи вывернуть эти всякие.
Человеческий череп начинает ломаться при приложении усилия всего в 360 кг.
Вес, который соответствует этой массе считается по формуле P = mg;
где P - вес, m - масса, g - ускорение свободного падения.
Измеряется вес в Ньютонах.
Дальше, берёшь второй закон Ньютона, и формулу оттуда: F = ma;
где m - масса, а - ускорение тела, F - сила, необходимая для ускорения.
Учитывая, что ускорение a = (v1 - v0)/t, где (v1 - v0) - разница скоростей, t - время ускорения,
И учитывая что ускорение зависит от изменения скорости за единицу времени - получаешь силу,
которая тормозит объект до нуля или до скорости, с которой этот объект отлетает,
просто потому что торможение это отрицательное ускорение и для него надо силу приложить.

Дальше, по третьему закону ньютона, с учётом того, что сила действия равна силе противодействия -
получаешь силу, с которой летящий объект воздействует на ударяющийся объект.
Зная площадь места их контакта - можешь и давление рассчитать, по формуле:
p = F/S, где F - сила, F - площадь, p - давление.

Ну, а дальше уже ткани и травматология.
Аноним 19/04/17 Срд 23:15:08  410430
>>410424
>>410428
спасибо аноны. кстате нашел этого пидра
Ele sofreu traumatismo craniano leve e lesões no tórax, provocados pelo acidente inusitado.
No Hospital Márcio Cunha a informação clínica é que o estado de saúde de Roberto Carlos é estável e o paciente não corre risco de morrer.

короче выжил он и даже не парализован. и даже наверняка может постить в /b.
Аноним 19/04/17 Срд 23:17:52  410433
Какие есть способы преобразования (упрощения) электрических цепей?
Аноним 19/04/17 Срд 23:29:56  410434
>>410433
Вариационная оптимизация:
https://books.google.com/books?id=P-TbAgAAQBAJ
Структурная оптимизация:
http://www.journals.kpi.ua/publications/text/2009_2_141_145.pdf
Эквивалентные преобразования электрических цепей.
Вот такое есть ещё:
https://kursovik.com/programming/140014.html
Также, существуют векторные и топографические диаграммы, и много всякого всего.
Аноним 20/04/17 Чтв 00:33:18  410442
Есть ли химические вещества которые повышают внушаемость человека? Снижают критическое мышление.
Аноним 20/04/17 Чтв 00:38:08  410443
1491268156.jpg (73Кб, 1274x792)
>>410361
Гм, теперь я снова нихуя не понял - в моменте, когда сокращённый член на самом деле оказывается несокращённым и протыкает мамашу насквозь.

Допустим, член излучает свет и мы видим его. Тогда получается, что он взаимодействует с нами посредством излучения как релятивистски сокращенный член.

Теперь берём этот член, запускаем в мамашу, и когда он по яйца в неё входит - он ВНЕЗАПНО исчезает. Мамаша изнутри покрыта специальным составом, который начинает светиться, когда рядом оказывается головка члена, изучающая свет. После исчезновения члена пизда мамаши будет светиться на полную длину покоя члена или на его релятивистски сокращенную длину? По идее, в системе наблюдателя-пизды член будет сокращенным виден, а значит, на сокращенную?
Аноним 20/04/17 Чтв 00:39:33  410444
>>410442
Можно было бы временно засрать рецепторы наркотой, но стоит только осознать наёбку и пиздец блядь,
потому что пути протекания нервного импульса миелинизируются в процессе обучения нейросети.
Аноним 20/04/17 Чтв 08:31:57  410465
просто самый тупейший вопрос, но ладно
есть один бассейн 743, площадь 28 метра квадратных, объем = 84 кубометра. а сколько надо тогда литров воды (чтоб наполнить его максимально)? почему везде пишут по разному, кто-то пишет, что 84 кубометра = 84 литра, а кто-то пишет, что 84 кубометра = 84000 литров? Кому верить?
Аноним 20/04/17 Чтв 08:32:22  410466
>>410465
>7x4x3
Аноним 20/04/17 Чтв 09:18:44  410467
>>410443
>он взаимодействует с нами посредством излучения
this
т.е. не член сокращается, а мы видим его коротким, только из-за того что излучение от него пиздует с конечной скоростью. которая скорость света
при этом
>пизда мамаши будет светиться на полную длину покоя члена
да, вот такая она, пизда мамаши опа)
>По идее, в системе наблюдателя-пизды член будет сокращенным виден, а значит, на сокращенную?
нет, идея в том что когда хуй летит со скоростью света он КАЖЕТСЯ коротким наблюдателю, а не СТАНОВИТСЯ коротким
Аноним 20/04/17 Чтв 10:47:10  410468
>>410467
да, вот такая она, пизда мамаши опа)

Но это же нечем не отличается от измерения интервала в лабораторной системе, т.е. мы измерим укороченный член.
Аноним 20/04/17 Чтв 10:48:39  410469
>>410385
это примерно, или вот так, ПРИМЕРНО тоже самое, просто в одном случае ты наверное усваиваешь чуть больше, когда конспектируешь.

В моем случае это было не так. потому что я нихуя не могу разобрать что пишу когда приходится это делать быстро
Аноним 20/04/17 Чтв 10:52:36  410470
>>410413
спасибо анон
другой анон
Аноним 20/04/17 Чтв 11:27:18  410474
В звездах достаточно энергия для образования гелия и прочего. Они соединяются, образуется сильная ядерная связь в ядре. А в ядерной бомбе эта связь рушится и выпускается огромное кол-во энергии. Это сильное взаимодействие превращается в энергию? Ведь для его создания в ядре используется огромное кол-во энергии. Так может глюон состоит из энергии?
Аноним 20/04/17 Чтв 12:50:32  410479
>>410474
>Так может глюон состоит из энергии?
ну энергия имеет разные проявления, с таким же "успехом" можно сказать что фотон энергия, но эти частицы имеют энергию, причем разную.
>Это сильное взаимодействие превращается в энергию?
На самом деле (Вроде бы в одной лекции Фейнман говорил, поправите если ошибаюсь) из за того что сильное взаимодействие не может удержать все протоны в ядре, их разносит уже из за электромагнитных сил. то есть отталкиваются плюс от плюса.
как то так

Аноним 20/04/17 Чтв 14:08:28  410484
>>410479
То-есть такой мощный взрыв создается из-за слабого взаимодействия?
Аноним 20/04/17 Чтв 14:27:51  410489
poПолитика14624[...].webm (420Кб, 1280x720, 00:00:01)
>>410444
>протекания нервного импульса миелинизируются в процессе обучения нейросети.
Аноним 20/04/17 Чтв 14:33:11  410490
>>410484
>из-за слабого взаимодействия?
из-за электромагнитного же
Опять же, я это услышал в одной из лекций Фейнмана
просмотри все лекции если не видел, очень годная тема
Аноним 20/04/17 Чтв 16:04:06  410491
>>410385
Что бы иметь общее представление о предмете.
Аноним 20/04/17 Чтв 16:05:33  410492
14908141842230.webm (496Кб, 1280x720, 00:00:10)
>>410491
>Что бы
Ты из какого класса?
Аноним 20/04/17 Чтв 16:44:58  410495
3103756original.jpg (257Кб, 1360x617)
>>410492
Млекопитающее.
Аноним 20/04/17 Чтв 17:15:40  410497
>>410495
Порванному хохлу пройти в /ро/
Аноним 20/04/17 Чтв 19:03:27  410504
db[1].gif (3Кб, 705x63)
db=20*log(v1/v2)
Как выразить из этой формулы v1?
Уже напрочь забыл и алгебру и матан...
Аноним 21/04/17 Птн 00:40:48  410523
>>410495
Можно сурс? А то что-то не верится, что Маркс мог такую годноту написать.
Аноним 21/04/17 Птн 00:42:47  410524
Всегда мучал вопрос, почему ток (электрончики), если он двигается почти со скоростью света, не разряжается сразу в случае замыкания цепи? Там так много электронов, что, даже двигаясь со скоростью света, им требуется куча времени или я чего-то не понимаю? Какая скорость перемещения электронов/чем обусловлена скорость разрядки батареи?
Аноним 21/04/17 Птн 01:16:07  410534
>>410524
а они двигаются со скоростью света?
Аноним 21/04/17 Птн 01:35:44  410541
>>410534
А с какой?
Аноним 21/04/17 Птн 03:36:39  410545
blob (57Кб, 241x209)
Я тут изрядно заправился научпопом, и со своим теперь охуенным непониманием приперся сюда.

Типа один из мысленных экспериментов про эквивалентность массы и энергии в том, что если мы возьмем невесомую и абсолютно отражающую коробку, и запустим внутрь фотонов, то, благодаря тому, что у фотонов таки есть момент, коробка начнет делать движения губами и языком, словно у нее есть масса.

Так вот, я нашел эту картинку, умилился, было, надписи 100 грамм, но потом вспомнил про тот эксперимент. Ну и что да, E=mc^2. И не то что бы я не мог уравнение с одним неизвестным, если бы не был таким мудаком, который не может в последующую конвертацию юнитов во что-то более приземленное.

Так вот, если у нас есть такая коробка, и она ведет себя словно в ней 100 грамм, с чем можно сравнить энергию в ней?
Аноним 21/04/17 Птн 03:41:48  410546
>>410545
>с чем можно сравнить энергию в ней?
С пиздецом в размере скольки-то десятков кг плутония.
Мегатонны считай сам, мне лень.
Аноним 21/04/17 Птн 05:15:45  410550
>>410524
>Ток
>Скорость света
Милости прошу, вернуться в /b
Аноним 21/04/17 Птн 08:10:24  410552
>>410545
>она ведет себя словно в ней 100 грамм, с чем можно сравнить энергию в ней?
Ну, к примеру
Вынужденный распад урана, на Ba-139 и Kr-95 плюс два нейтрона. Выделяется примерно 0,822 грамма энергии с моля (235 грамм примерно). 100 грамм выделится при распаде 28,58 кг. Малыш Хиросимский переработал около 700 грамм (0,55 грамма, вики говорит что 0,6. Поверим вики, поскольку я учел только один вариант распада), что вылилось в 15кт тротила.
100 грамм, соответственно, будет порядка 668кт тротила.
Аноним 21/04/17 Птн 08:14:00  410553
>>410552
Хотя по моему я где-то накосячил. Вики говорит, что 100 грамм эквивалентно 2,148мт
Аноним 21/04/17 Птн 10:55:52  410555
Что такое "второе дыхание" в спорте с научной точки зрения?
Аноним 21/04/17 Птн 11:33:03  410556
>>410550
>The propogation of electric field, or electrical signalling using electrical signals in a wire is a bit slower. It can be anywhere from about 50% of c to 99% of c, depending upon the wire and insulation composition and construction.
chttps://www.quora.com/What-is-the-speed-of-electric-current
Аноним 21/04/17 Птн 11:40:58  410557
>>410556
А, всё, вопрос снимается.
>In your wire, the signal propagates very fast - about 97% of the speed of light in vacuum. But the electrons, once they start moving, are at a very slow drift speed of only a few cm/s.
Аноним 21/04/17 Птн 13:07:21  410560
>>410556
Может здесь поле имелось ввиду, а не электроны?
Аноним 21/04/17 Птн 15:31:16  410575
>>410465
1 литр = 1 куб. дециметру (а не 1 кубометру), так-что правильный ответ - 84000 л
Аноним 21/04/17 Птн 15:51:37  410576
Блядь, нихуя не пойму. Почему говорят, что ток - это свет и что он движется со скоростью околосветовой? Может, это поле движется с такой скоростью? Может они электрическое поле имеют ввиду?
Аноним 21/04/17 Птн 15:56:42  410577
>>410560
Даже не поле, а передача сигнала (информации).
Аноним 21/04/17 Птн 15:58:01  410578
>>410576
Ну ды, а поле двигает электроны, которые, правда, намного медленнее движутся (порядка миллиметра в секунду что ли, а в переменном токе туда-сюда катаются). Электрон, как любое массивное тело, до c не разогнать.
Аноним 21/04/17 Птн 15:59:21  410579
>>410576
С такой скоростью движется сигнал. Сами электроны движутся медленно, не более нескольких мм в секунду. Другой вопрос, почему это так, что, например, лимитирует скорость их движения.
Вот, предположим, сопротивление уменьшается - будет ли скорость тока возрастать? Или просто по закону Ома изменится только сила тока (амперы), а скорость останется неизменной?
Аноним 21/04/17 Птн 16:00:10  410580
>>410578
>массивное тело
Но ведь он весит почти в 2 000 раз меньше, чем протон.
Аноним 21/04/17 Птн 16:01:49  410581
>>410580
Но это всё равно не ноль!!!
Аноним 21/04/17 Птн 17:10:31  410583
Как обнаруживают объекты в космосе кроме телескопа? И почему челябинский метеорит не был обнаружен заранее?
Аноним 21/04/17 Птн 17:47:56  410586
>>410583
https://en.wikipedia.org/wiki/Rogue_planet#Observation
Аноним 21/04/17 Птн 17:51:59  410587
>>410541
медленно они двигаются, как шарики в трубке - один впихнул, а на другом конце один выпихнулся. где-то метра три в секунду. скорость света это про энергию/поле.
Аноним 22/04/17 Суб 02:30:46  410635
>>410555
Когда углеводы почти подошли к концу и пришло время жиров(и наверное белков).
Аноним 22/04/17 Суб 03:00:35  410638
>>410555
Походу, анаэробное дыхание, где вместо кислорода, митохондриями используются электроны и другие окислители.

Потому что вот: http://sportwiki.to/Второе_дыхание
Спортсмену при беге на стометровку требуется 7 литров кислорода, а успевает вдохнуть он всего лишь 0,3-0,5 литра. Несмотря на увеличившуюся частоту дыхания, учащение сердечной деятельности, организм за такое короткое время обеспечить потребность в кислороде не в силах и поэтому переключается на бескислородное дыхание (анаэробное), работая в "долг", который возмещается через какое-то время после прекращения нагрузки одышкой и сердцебиением.

Анаэробное дыхание — биохимический процесс окисления органических субстратов или молекулярного водорода с использованием в дыхательной ЭТЦ в качестве конечного акцептора электронов вместо O2 других окислителей неорганической или органической природы. Как и в случае аэробного дыхания, выделяющаяся в ходе реакции свободная энергия запасается в виде трансмембранного протонного потенциала, использующегося АТФ-синтазой для синтеза АТФ.
Осуществляется прокариотами (в редких случаях — и эукариотами) в анаэробных условиях.
https://ru.wikipedia.org/wiki/Анаэробное_дыхание
Аноним 22/04/17 Суб 05:49:01  410643
e4f903dd3430beb[...].jpg (20Кб, 350x388)
Возможно ли из двух яйцеклеток образовать зиготу? И если нет, то почему?
Аноним 22/04/17 Суб 06:08:59  410647
>>410643
Только лазером, походу:
https://www.kommersant.ru/doc/3212071
А вообще:
После оплодотворения в яйцеклетке образуются два ядра.
В момент, когда ядра яйцеклетки и сперматозоида готовы были соединиться,
мы изъяли их из двух яйцеклеток: родительский материал — ядра,
в которых содержится весь набор генов, — пересадили в донорскую яйцеклетку.
В результате, здесь родилась какая-то девочка: https://day.kyiv.ua/ru/photo/chudesa-reproduktologii
О хромосомах мужчины ни слова, но исходя из того, что ядра внутри яйцеклетки - сливаются,
можно сделать предположение о том, что они каким-то образом дополняют друг друга,
через мембраны какие-то там что-ли, и если взять и оплодотворить две яйцеклетки сразу,
а потом ядра когда сформируются, повытаскивать и запхнуть в третью яйцеклетку,
то не факт, что бабские ядра ваще будут сливаться, лол.
И не факт, что не родится какой-то зомби-мутант, с 45-ю с половиной хромосомами,
половина из которых, неведомая хуйня вроде родоначальницы тебя и даже ОП'а.
Аноним 22/04/17 Суб 06:33:38  410648
25015.jpg.913x-[...].png (202Кб, 913x475)
4197728i016.png (31Кб, 600x391)
img-YbNmGw[1].png (196Кб, 408x584)
image025[1].jpg (23Кб, 458x380)
>>410647
Ядра сливаются походу потому, что в ядре сперматозоида и яйцеклетки - разные мембраны.
На пик2, они штрихами показаны, и как-бы дополняют друг-друга.
Алсо, пик4 - два пути развития половых клеток.
Пик3 - просто показан набор хромосом одинаковый, по 23 в каждом ядре.
Пик1 - тоже какая-то оболочка дополнительная.
Хотя, можно было бы и внутрь сперматозоида запхнуть эти хромосомы из яйцеклетки.

Аноним 22/04/17 Суб 08:17:30  410651
>>409550 (OP)
Мне одному кажется странным, что скидеты всяких древних гоминид начали "находить" сразу после того как была зафоршена теория эволюции?
Аноним 22/04/17 Суб 08:18:01  410652
>>410651
скелеты*
Аноним 22/04/17 Суб 13:24:05  410666
Как в атомной бомбе происходит ядерный распад?
Аноним 22/04/17 Суб 13:36:52  410667
>>410666
Почему сразу распад? Может это термоядерная бомба и там синтез?
Аноним 22/04/17 Суб 16:43:51  410672
>>410667
Ну в ядерной блядь.
Аноним 22/04/17 Суб 16:52:20  410673
>>410666
не для того тебя в школе неправильно учили чтоб сейчас ты всё узнал
Аноним 22/04/17 Суб 16:53:40  410674
>>410673
Аргументы будут?
Аноним 22/04/17 Суб 16:55:54  410675
Я просто блядь хочу все подробно узнать, что как преобразуется, что со связями становится.
Аноним 22/04/17 Суб 16:56:19  410676
>>410651
а то что элементарные частицы начали находить после того как была зафорщена квантовая теория тебя не смущает?
Первый череп неандертальца был найден в Бельгии еще в 1829 году. Вторая находка 1848 года связана с английской военной базой на Гибралтаре. Но признаны эти первые находки неандертальскими позднее, в 1836 и 1864 году, соответственно
Аноним 22/04/17 Суб 17:03:45  410678
socrates discip[...].png (1513Кб, 2874x3416)
>>410674
подборочка когнитивных диссонансов имплантированная в сознание учащихся с тем чтоб они могли понять лишь что эти вещи их скудным умишкам не под силу, и остаётся лишь вызубрить, повторить и забыть как страшный сон, аргументом является?
на уроках химии это когда в первой четверти тебе рассказывают что электрон не может приближаться к ядру из-за силы отталкивания, а во второй четверти тебе показывают p-орбиталь.
а на уроках физики это копенгагенская интерпретация, где волновая функция внезапно описывает не вероятность, а реальность. где одиночная частица обладает волновыми свойствами и проходит через две щели одновременно несмотря на то, что после выяснилось что видеорилейтед https://www.youtube.com/watch?v=FCoiyhC30bc продолжают преподавать это дерьмецо опровергнутое ещё при его появлении.
на уроках геометрии тебе дают перанальные доказательства евклида вместо понятных пифагорейских
на уроках литературы тебе объясняют что горе от ума.
Аноним 22/04/17 Суб 17:57:46  410679
>>410678
>где волновая функция внезапно описывает не вероятность, а реальность, где одиночная частица обладает волновыми свойствами и проходит через две щели одновременно
Кек. Это где такое преподают?
>на уроках химии это когда в первой четверти тебе рассказывают что электрон не может приближаться к ядру из-за силы отталкивания, а во второй четверти тебе показывают p-орбиталь.
А вот с этим трудно поспорить.
>на уроках геометрии тебе дают перанальные доказательства евклида вместо понятных пифагорейских
Че это за хуйня? Не проходил еще.
>на уроках литературы тебе объясняют что горе от ума.
Наверное там намекали на безысходность жизни талантов в империи.
Аноним 22/04/17 Суб 18:27:30  410683
>>410679
>Не проходил еще.
Мальчик, сколько тебе лет?
мимо педофил
Аноним 22/04/17 Суб 19:18:22  410690
Закатился в раздел, у меня 3 вопроса:
1. Почему в разделе такая "любовь" к сети?
2. Есть ли какие-нибудь хорошие аналогии, переводящие все или большинство характеристик квантового микромира и взаимодействий на привычные вещи в обычном мире?
3. Когда говориться о недетерминированном характере квантового микромира имеется ввиду что он такой только для наблюдателя? Т.е. пытаясь что-то очень точно измерить мы вносим изменения, но в принципе все законы взаимодействия квантовых частиц полностью детерминированы и в принципе, если магическим образом знать состояние абсолютно всех частиц мы со 100% вероятностью можем предсказывать любые состояния в любой момент времени?
Аноним 22/04/17 Суб 19:24:38  410691
>>410690
> 3. Когда говориться о недетерминированном характере квантового микромира имеется ввиду что он такой только для наблюдателя? Т.е. пытаясь что-то очень точно измерить мы вносим изменения, но в принципе все законы взаимодействия квантовых частиц полностью детерминированы и в принципе, если магическим образом знать состояние абсолютно всех частиц мы со 100% вероятностью можем предсказывать любые состояния в любой момент времени?
Это уже вопрос интерпретации. Есть яростные веруны в то, что всё вокруг магическим образом появляется из вселенского хранилища рандома только при взаимодействии, а есть копротивленцы за полный детерминизм и скрытые маняпараметры. Но штука в том, что что те, что другие выводы делаются абсолютно из ничего, на уровне "ПОТОМУ ШТО Я ТАК СКОЗАЛ". Так что данный вопрос относится к числу непознаваемых сущностей и абсолютно никакого смысла, кроме пустого срача, не имеет по причине отсутствия каких-либо данных.
Аноним 22/04/17 Суб 19:32:04  410692
>>410691
>а есть копротивленцы за полный детерминизм и скрытые маняпараметры
А разве для полного детерминизма текущей квантмеханике нужны еще какие-то маняпараметры?
Я к тому что в принципе глобально все детерминировано, но воспользоваться ею, будучи частью системы, невозможно.
Детерминист 22/04/17 Суб 20:15:09  410698
А давайте разделимся на детеминистов и хаосистов, чтобы сразу знать с кем ты говоришь? Для оирентировки предлагаю в строке "Имя" писать кто ты.
Аноним 22/04/17 Суб 20:22:20  410699
>>410698
А в каком из отрядов платят?
Аноним 22/04/17 Суб 20:23:02  410700
>>410698
Твоюмамкуебист 22/04/17 Суб 20:26:25  410703
>>410698
А если я не отношусь ни к тем, ни к другим?
Аноним 22/04/17 Суб 20:27:52  410704
>>410699
Там где за бога и скрепы топишь
Аноним 22/04/17 Суб 20:35:45  410705
>>410692
так в том и прикол, что формализм квантовой механики это по сути тервер+функан+линал+группы, модели носят вероятностный характер.
Детерминист 22/04/17 Суб 20:37:30  410706
>>410699
В отряде детерминистов конечно же..
.>>410703
Ну тогда ты нейтральный.
Аноним 22/04/17 Суб 20:54:37  410708
255uCN5xBAg58Y.jpg (61Кб, 542x696)
Подать ток в 1 Ампер.
Что это значит?
Как я могу подать ток, если для тока нужно напряжение?
Я что, электронами в провод буду стрелять?

А источник тока, это ведь наёбка?
По сути, это источник напряжение, который автоматически подстраивается под нагрузку чтобы выдать необходимый ток, так или нет?
Аноним 22/04/17 Суб 20:58:53  410710
>>410708
Так или нет
Аноним 22/04/17 Суб 21:04:57  410711
>>410708
Поле же можно подать.
Аноним 22/04/17 Суб 21:44:44  410712
>>410708
Можешь и стрелять тащемта. Мало ли причин, по которым заряженная частица куда-то собралась? Градиент концентрации у ней туда показывает, или, может, гравитацией тянет. Дай им достаточно вескую причину, и носители заряда пойдут хоть против поля.
И не "наёбка", а "какая полезная модель, спасибо вам, просвещённые естествоиспытатели восемнадцатого века, за вашу творческую энергию". Пидр.
Аноним 22/04/17 Суб 21:59:41  410713
>>410708
Не путай понятия источник тока и источник напряжения. В электротехнике это немного разные вещи.
Аноним 22/04/17 Суб 22:13:41  410714
Я тут задумался и оказалось, что я верил в концепцию плоской земли. Я хорошенько ее спрятал за тем, что земля это шар так как считал что она со стороны шар, а внутри где-то посредине между газом и земной твердью она плоская, ну, может есть горы, но не суть. Я когда-то задумывался о том есть ли границы, можно ли упасть с границы Земли, но не думал что это связанно с тем, что земля плоская или круглая и быстро не придавал этому значения. Так что на самом деле есть шар, а люди удерживаются на нем лишь гравитацией и со стороны австралийца какого-то будет казаться, что люди вверх ногами держатся на шаре и наоборот? И на самом деле оно так и есть, но сильно спрятано и так нельзя увидеть мир? Доведите меня к уму, пожалуйста.
Аноним 22/04/17 Суб 22:15:03  410715
>>410714
>между газом и земной твердью она плоская
В смысле там горизонт и по горизонту люди ходююют!
Аноним 22/04/17 Суб 22:24:22  410716
>>410698
я детерминист и в общем wololo:
>>410691
> штука в том, что что те, что другие выводы делаются абсолютно из ничего
Смотри как выводится детерминизм: волнавая природа света мало чем отличается от волновой природы воды. Ты же не станешь отрицать, что каждая молекула воды принимает своё положение во взаимодействии с окружающими её молекулами. Так и фотоны взаимодействуют с окружающим миром, но внешний мир настолько сложный и перенасыщенный полями что рассчитать их совершенно невозможно и приходится довольствоваться вероятностями.
Аноним 22/04/17 Суб 23:03:54  410717
wtf..jpg (22Кб, 867x427)
>>410708
>Я что, электронами в провод буду стрелять?
Да. Будешь проталкивать электроны по проводнику так что они с того конца посыпятся.
Аноним 23/04/17 Вск 02:46:43  410735
02351e3d44480ea[...].jpg (610Кб, 800x900)
После phd в компутер сайенс, хочу считать и кодить в НАСА, а затем улететь на Марс с первой же партией рободевочек. Какие подводные камни?
Аноним 23/04/17 Вск 04:10:43  410737
>>410355
Понятие первичности не имеет смысла в закрытых системах
Это как вопрос что толкает что: электрический ток магнитную волну или магнитная волна электрический ток
Это в принципе не правильная постановка вопроса
Аноним 23/04/17 Вск 10:57:34  410752
>>410713
ну так объясни, если разные.
Аноним 23/04/17 Вск 11:38:31  410755
>>410676
Так элементарные частицы и не нашли еще не одной. ИХ постулируют исходя из косвенных наблюдений. Как гены до 50х годов.
Аноним 23/04/17 Вск 12:31:29  410759
>>410755
А что тебе нужно, чтобы "найти" частицу? Увидеть её глазками, штоле?
Аноним 23/04/17 Вск 12:46:00  410760
p4dpI5a (1).jpg (101Кб, 800x451)
>>410759
>тебе
Не мне, а учёным.
Аноним 23/04/17 Вск 12:51:33  410762
>>410759
не корми мудака
Аноним 23/04/17 Вск 13:02:30  410764
>>410762
>Прямо в стандартной модели постулируется, что кварки никто и никогда не увидит в свободном виде, это просто невозможно в принципе.
>ты мудак если не веришь в то что кварки существуют
^_^
Аноним 23/04/17 Вск 13:04:30  410765
>>410760
То есть всё, что учёные не могут увидеть глазками, а только другими методами наблюдения и взаимодействия - то не существует в принципе и вообще ВРЁТИ?
покормил-таки мудака,ну да ладно
Аноним 23/04/17 Вск 13:08:38  410766
>>410765
> элементарные частицы и не нашли еще не одной
> то не существует в принципе
Отличный соломенный человек, но нет.

Кстати. Путаешь причину и следствие, то чего учёные не могут пронаблюдать непосредсвенно называется гипотетическим объектом, такие объекты постулируются и наблюдаемые явления типа следа в конденсационной камере приписываются делу рук этих гипотетических сущностей, а не наоборот.
Аноним 23/04/17 Вск 13:14:30  410768
>>410766
> пронаблюдать непосредсвенно
И что ты под этим имеешь в виду? Окружающий мир ты тоже не наблюдаешь непосредственно, а только посредством твоих глазок и прочих органов чувств, гипотетически постулируя существование реального мира. А вдруг ты - мозг в банке, которому просто на вход подают определённые сигналы и на самом деле никакого реального мира вокруг нет? На самом деле лежишь в капсуле, а всё вокруг - Матрица и иллюзия? А вдруг то, что мы наблюдаем как электрон - на самом деле твоя мамаша, просто она ведёт себя как электрон?
Аноним 23/04/17 Вск 13:44:15  410771
>>410752
Ну раз тебе гуглить лень.
В источнике тока ток не зависит от нагрузки, а напряжение зависит. В источнике напряжения наоборот - напряжение не зависит от нагрузки, а ток зависит.
Аноним 23/04/17 Вск 13:46:19  410772
>>410764
где это постулируется в СМ? это раз
А во-вторых, из того что на эксперименте мы их не наблюдаем, как адроны, это не значит, что нет других способов проверки их существования. У тебя логикой беда.
Аноним 23/04/17 Вск 13:53:21  410773
>>410768
То что подразумевается под непосредственностью в физике. При помощи одного из органов чувств.
Аноним 23/04/17 Вск 13:57:04  410774
>>410772
Конфайнмент.
>способов проверки их существования
Чего? Выдуманный сущностей? Причём тут логика?
Аноним 23/04/17 Вск 14:02:37  410775
>>410773
Лел, так органы чувств - те же самые приборы, и всё, что ты ними видишь - это не непосредственная реальность, а лишь определенный набор информации, на основании которого ты строишь свои гипотетические модели реальности. В чём обьективная разница между глазом и камерой как измерительными инструментами? И то, и то даёт лишь убогую проекцию гипотетической реальности.
Аноним 23/04/17 Вск 14:08:42  410776
>>410774
>Конфайнмент.
Еще раз, это не постулируется. Это непертурбативный эффект.
Аноним 23/04/17 Вск 14:10:39  410777
14642551963030.jpg (32Кб, 1280x720)
>>410775
Я вообще не понимаю о чём ты. Не смог состряпать соломенное чучело и решил сменить тему? Браво. Свяжи тобою написанное с исходным тезисом.
"Элементарные частицы не были открыты."
Твои маня кварки ненаблюдаемы ни прибором ни глазом наблюдающим за прибором ни любыми комбинациями прибора и глаза, это прямо в теории постулируется, как у христиан постулируется что бог не наблюдаем так и тут.
Аноним 23/04/17 Вск 14:13:59  410778
>>410776
Пошло отрицание. Думаю с тобой можно разговор окончить. Неужели ты рассчитываешь что я продолжу разговор с дауном скатившимся в педанство. Разрешаю тебе оставить за собой последнее слово.
Аноним 23/04/17 Вск 14:14:54  410779
>>410778
педанство*
Аноним 23/04/17 Вск 14:16:40  410780
>>410778
Лол, не думал, что так быстро ливнешь. Ну ок.
Аноним 23/04/17 Вск 14:18:06  410781
>>410777
Ну так физики хотя бы пытаются объяснить конфайнмент, хоть пока и безуспешно. Постулат о ненаблюдаемости - временная мера. Вот отличие науки от религии.
мимопроходил
Аноним 23/04/17 Вск 14:22:12  410782
>>410781
И ты туда же. Постулируется вид лагранжиана, все остальное считается. Окей?
Аноним 23/04/17 Вск 14:23:16  410783
>>410777
Я, в свою очередь, не понимаю, куда ты маняврируешь. То у тебя нужно непосредственно глазом или ухом пронаблюдать кварки, а если нет - то это будет гипотетическая частица и ВРЕТИ НЕ ДОКАЖЕТИ. То ты маняврируешь обратно и говоришь "ну лан кароч можно и прибором пронаблюдать но всё равно ЗАРЕГИСТРИРОВАТЬ НЕПОСРЕДСТВЕННО САМУ ЧАСТИЦУ ИНАЧЕ ВРЁТЕ ТУПЫЕ ВИРУНЫ".
Дебилушка попросту не может понять, что абсолютно всё, что мы думаем/знаем о мире вокруг и его реальности - не более чем гипотетическая модель. Допустим, мы наблюдаем электрон и постулируем, что это такая-то частица с такими-то свойствами, потому что такое её введение в модель позволяет обьяснить многие наблюдаемые прямо хотя это тоже "косвенно", т.к. такой вещи, как "прямое наблюдение", попросту не существует, косвенно и очень косвенно явления. Доказать, что электрон существует, ты не сможешь в любом случае - у тебя лишь есть набор данных, из которых ты постулируешь его существование ради удобства обьяснения и ради главного -
предсказательной силы теории. А так там может сидеть хоть Аллах в каждой частице, хоть твоя мамаша - всем похуй, ибо рассуждения о непознаваемых в принципе сущностях для пидоров и онанистов.
Аноним 23/04/17 Вск 14:37:41  410784
В моей больной голове созрела такая догма: человек, хоть и обладает сознанием, всего лишь результат явлений нашей вселенной и по сути такой же набор частиц, как и любой камень. Исходя из этого можно сказать, что единственной целью человека разумного может быть поиск ответов на вопросы мироздания (Как появилась вселенная и т.п.), либо можно смириться с фактом, что мы просто животные и жить в свое удовольствие. А любое другое занятие на серьезных щщах, будь то политическая деятельность, например, не более чем глупость, и не имеет ни малейшего смысла.
Где я неправ?
Аноним 23/04/17 Вск 14:53:27  410786
Сап наукач. Действительно ли мемристор обладает более высоким частотным потенциалом чем транзистор?
Аноним 23/04/17 Вск 15:40:33  410789
>>410784
> поиск ответов на вопросы мироздания
является ровно такой же бессмысленной хуитой, как и
> любое другое занятие на серьезных щщах
Аноним 23/04/17 Вск 15:50:16  410790
>>410789
Спору нет, я к тому, что все остальное это завуалированное удовлетворение животных потребностей, а вот тяга к знаниям нечто исключительное. А может и нет.
Аноним 23/04/17 Вск 16:01:05  410791
>>410784
>всего лишь результат явлений нашей вселенной и по сути такой же набор частиц, как и любой камень
> Исходя из этого
>можно сказать, что единственной целью человека разумного может быть поиск ответов на вопросы мироздания
ОБЪЯСНИ МНЕ КАК ИЗ ПЕРВОГО ТЫ СДЕЛАЛ ТАКОЙ ВЫВОД?
Аноним 23/04/17 Вск 16:11:35  410792
tumblrlz7o4hc4e[...].jpg (66Кб, 434x600)
Достаточно глупо для треда. Я ищу набор детальных инструкций со ссылками на исследования обо всех аспектах здоровой и продуктивной жизни (ученого, а не космодесантника). Что-то вроде топ-сикрет тренировочных программ для будущих марсианских колонистов или распорядок дня у запертых в мрачных подвалах китайских корпораций или Гугла.
Когда, как, что есть-пить-спать, какие делать упражения, каким воздухом дышать и при каких показателях на ЭЭГ бить током. Я могу приобрести необходимое оборудование, сдавать кровь на анализ и да и вообще все необходимое для чего не нужен бюджет как у НАСА.
Аноним 23/04/17 Вск 16:12:39  410793
>>410791
Ну подумай сам. Мы отличаемся от животных и тех же камней, только тем, что можем понимать в какой-то мере мир который нас окружает. Отсюда и вывод. Я же написал про сознание с самого начала.
Аноним 23/04/17 Вск 17:04:21  410795
>>410714
Памагитиыы
Аноним 23/04/17 Вск 17:55:57  410799
Если пахучее вещество источает запах, то оно постоянно теряет немного в весе? (Насколько я знаю, запах - это воздействие определённых пахучих частиц на рецепторы в носу).
Аноним 23/04/17 Вск 18:00:57  410800
Аноны, в свое время я практически не учился. В особенности это касается математики. Сложение и вычитание более-менее знаю и в повседневности этого хватает, но вот с умножением и делением все не так радужно (Хотя и не сказать что совсем дуб дубом). Теперь жалею что раньше не спохватился, но ведь не все потеряно, чай коньки отбрасывать не собираюсь.
Ближе к делу - подскажите хороших книг по математике с первого (Лучше перебдеть и прочесть с самых основ, даже если ничего нового не узнаю) и по десятый (Или какой нынче конечный) классы. Желательно - с ссылками на файлы или онлайн.
Аноним 23/04/17 Вск 18:22:19  410801
>>410799
Если бы это было так, то твоя мамаша давно бы испарилась, ибо она воняет хуже выеблеванного говна спидозного бомжа.Да, это так. Что за глупый вопрос?
Аноним 23/04/17 Вск 19:17:03  410807
1492818164119.gif (141Кб, 720x228)
>>409550 (OP)
Что такого ахуенного в числе Пи?
Аноним 23/04/17 Вск 19:51:48  410808
>>410792
А вот это, пожалуй, бампану
Аноним 23/04/17 Вск 19:53:14  410809
>>410807
Если любую длину окружности разделить на её диаметр, то всегда будет это число.
Аноним 23/04/17 Вск 21:26:54  410814
1484135144337.png (334Кб, 376x505)
>>410809
Ну и чё? Как с этого ахуеть можно?
Аноним 23/04/17 Вск 21:32:09  410815
20160818001933.JPG (103Кб, 552x800)
>>410792
И я тогда тоже присоединяюсь к вопросу. Ибо в инетике куча противоречивой, беспруфной и откровенно кликбейтовой инфы о том, что эффективно и полезно, а что нет.
Аноним 23/04/17 Вск 21:32:11  410816
Мне еще в мат треде на просьбу дать учебник физики в котором бы шла и математика посоветовали учебник который обозвали "ПТУшным для даунов", я его давно проебал. Может подскажет кто? Помню там и правда математика еще была, ну по типу "вот так и вот так остальное тебе знать не нужно" в то время как во всех остальных всегда было "как ты знаешь из уроков математики это должно быть так".
Аноним 23/04/17 Вск 21:35:28  410817
Ген убеждений.webm (1984Кб, 640x360, 00:00:18)
Почему в прошлом было так много знаменитых физиков ставших знаменитыми сами собой без популизаторства на ютубе, а сейчас ни одного? Последний кто был это Фейнман. Довольно странно на фоне общего роста интереса к науке среди простого обывателя.
Аноним 23/04/17 Вск 21:52:48  410819
q8wf.PNG (15Кб, 522x110)
949794.PNG (46Кб, 560x154)
внешний электронный слой это когда две цифры одинаковые или как есть ?

например д) должно быть :

6s 6p или 5d 6p ?
Аноним 23/04/17 Вск 21:58:35  410820
>>410819
>внешний электронный слой
это энергетические уровни, которые полностью не заполнены или-и активно участвуют в химических реакциях. С одинаковыми цифрами это не связано.
Аноним 23/04/17 Вск 22:29:46  410823
Не знаю, где еще можно спросить.
В какой программе можно нарисовать диаграмму целей/приоритетов?
Аноним 23/04/17 Вск 22:32:20  410824
>>410823
FreeMind
Аноним 23/04/17 Вск 22:33:18  410825
>>410824
>FreeMind
мужик, спасибо большое!
Аноним 23/04/17 Вск 22:33:44  410826
>>410820
в инертных газах заполнены.
а в заряженных ионах бывают заполнены?
Аноним 23/04/17 Вск 22:36:15  410827
>>410825
Мне приятна твоя благодарность, человек.
Аноним 23/04/17 Вск 22:39:21  410828
>>410820
как это задание решить ? 6s2 6p2 Это внешний электронный слой ?
Аноним 23/04/17 Вск 22:58:20  410830
-
Аноним 23/04/17 Вск 23:04:28  410831
>>410828
В данном случае обмана нет. Чтобы решить, нужно просто посчитать количество электронов на уровнях ниже 6s2 + 6s2 6p2.
Короче, если в теории, там с заполнением орбиталей все не так гладко, много исключений из, но это не требуется в задании. Нужно считать как написано выше. Химия вообще на магию похожа в школе, смирись.
Аноним 23/04/17 Вск 23:28:27  410832
Дробышевский, отвечая на вопросы о связи размера мозга и интеллекта у людей(как современных так и предков), часто делает акцент на коэффициенте энцефализации как более точно коррелирующим с интеллектом нежели абсолютный размер мозга. А вот в этой статье утверждается, что абсолютный размер мозга, а не коэффициент энцефализации является лучшим предиктором когнитивных способностей среди "нечеловеческих" приматов. Люди это не "нечеловеческие" приматы, но может быть это должно породить сомнения в приоритетности коэффициента энцефализации над абсолютным размером мозга при оценке когнитивных способностей у людей и их предков?
https://www.ncbi.nlm.nih.gov/pubmed/17510549
химияя Аноним 24/04/17 Пнд 00:02:33  410834
какой современный способ используют для составления конфигурации ?
Аноним 24/04/17 Пнд 00:03:15  410835
adadadasfsa.PNG (3Кб, 556x28)
к посту выше
Аноним 24/04/17 Пнд 10:54:24  410845
Сильно ли по физиологии отличается мужской и женский анус?
Аноним 24/04/17 Пнд 12:09:46  410847
>>410817
Фейнмана уже с детства готовили, тащемто. Как и многих ученых всяких. Отдавали в элитные ясли и т.д. и т.п.
Аноним 24/04/17 Пнд 12:10:42  410848
>>410807
https://github.com/philipl/pifs
Там можно хранить информацию.
Аноним 24/04/17 Пнд 12:57:44  410850
>>410847
Там их учили как просто и без задней мысли стать знаменитыми? Типа двигаешь тазом, рычишь, щуришь глаза и постепенно входишь в историю?
Аноним 24/04/17 Пнд 13:00:48  410851
Вот есть тесты IQ, понятно что бушмены набирают по ним мало балов потому что они в ебенях живут, но очевидно же если IQ и претендует на объективную оценку интеллекта то надо бы было узнать у сами бушменов насколько умными они считают набравших высокие балы бушменов и насколько глупыми бушменов с низкими балами. Это бы дало ценную информацию. Такие исследования проводились?
Аноним 24/04/17 Пнд 14:55:17  410854
>>410851
>ценную
Для кого?
Аноним 24/04/17 Пнд 15:17:25  410855
>>410851
Ну дык бушмены будут оценивать друг друга не по реальной способности решать интеллектуальные задачи, а по своим бушменским меркам - кто у них больше альфач или кто среди них самый хитрожопый шаман, того и изберут дружно самым умным, хотя на деле, уверен, это будет нихуя не так, ибо альфовость и умение наёбывать других нихуя не означают ум и сообразительность. Короче, если IQ-тест во многом необьективен, то оценка бушменами друг друга будет необьективной полностью.
Аноним 24/04/17 Пнд 16:54:30  410857
Двач, как определяется НОД более чем двух элементов кольца? В учебнике предлагается сделать это самостоятельно на основании свойства НОД(a, НОД(b, c)) = НОД(НОД(a, b), c). Но я что-то не соображу как это сделать.
Аноним 24/04/17 Пнд 17:58:21  410858
>>410855
С чего ты взял что они не будут оценивать друг друга по способности решать интеллектуальные задачи? Как еще они могут оценивать интеллект, или ты имеешь в виду не по тем интелектуальным задачам которые волнуют нас, нов этом и смысл - узнать, насколько бушменская концепция интеллекта соотносится с нашей.
Аноним 24/04/17 Пнд 18:29:55  410859
qwfwefgew.PNG (7Кб, 483x80)
что делать если последний слой одинаковый ?

1)как можно различить их ?

2)К примеру я хочу узнать какой это элемент по внешнему слою
Аноним 24/04/17 Пнд 18:35:20  410860
>>410858
А тебе не насрать, какая концепция интеллекта у бушменов, если сегодня в мире интеллект нужен совсем другой? Ты бы ещё спросил у обезьян, какая у них концепция интеллекта, лол. Проводить соцопросы среди бушменов, кого они считают среди своего племени самым умным - это всё равно что проводить соцопросы среди обезьян, кого они из своей стаи считают самым умным. Занятие интересное, но крайне бесполезное.
Аноним 24/04/17 Пнд 18:56:35  410861
>>410860
Нет. Это же одна из основных критик тестов IQ, что они культурно обусловлены. А если выяснится ,что и в культурах в которых концепции интеллекта отличаются от нашей тест IQ всё еще работает, то это большой + к корректности теста.
Аноним 24/04/17 Пнд 18:59:41  410862
>>410859
Открой таблицу Менделеева и посмотри. Если ты не способен выявить закономерность таким образом то лучше выпиливайся.
Аноним 24/04/17 Пнд 19:35:23  410864
>>410862
КЫШ отсюда. циник и мизантроп
Аноним 24/04/17 Пнд 20:37:21  410868
>>410850
Да. Возле них крутились люди и рассказывали кучу научных баек, делали всякие эксперименты и прочая.
Аноним 24/04/17 Пнд 20:45:45  410870
>>410868
А сейчас курс "как стать знаменитым" исключили из программы?
Аноним 24/04/17 Пнд 21:16:13  410871
Поясните за слабое взаимодействие. С тремя остальными все понятно, что-то притягивается или отталкивается от чего-то, а со слабым какой то непонятный пиздец. Что это вообще такое?
Аноним 24/04/17 Пнд 22:21:59  410874
>>410871
вики уже прочитал, что там непонятного?
Аноним 24/04/17 Пнд 22:27:56  410875
14869120971470.png (282Кб, 625x626)
IMG201606121153[...].jpg (547Кб, 1944x2592)
Одно милое существо пообещало мне какао с зефирками за решение нижеследующей хуйни. Так-то какао с зефирками можно и самому купить, а в нижеследующей хуйне я ничегошеньки не понимаю — быдло я, только схемотехнику учил, да и то позабыл за ненадобностью — но всё равно был бы благодарен за ответ. В свою очередь доставлю по реквеству. Картинка просто так.

Является ли множество всех подмножеств произвольного множества группой относительно операции симметрической разницы?
Является ли данное множество кольцом, относительно операции симметрической разницы (аналог сложения) и операции пересечения множеств (аналог умножения)?
Является ли данное множество полем, относительно операции симметрической разницы (аналог сложения) и операции пересечения множеств (аналог умножения)?
Обоснуйте сделанное утверждение.
Аноним 24/04/17 Пнд 22:36:40  410876
>>410875
А на кого милое существо учится и почему оно не хочет, собственно, учиться тому, чему её упорно пытаются там научить?
Аноним 24/04/17 Пнд 22:39:45  410877
>>410876
Говорит, бьётся головой, но не въезжает в конкетную задачу. По специальности безопасник специально уточнил - Безопасность информационных и телекоммуникационных систем
Аноним 24/04/17 Пнд 22:41:54  410878
>>410877
>в конкетную задачу
Так где конкретная задача, то что выше набор фактов проверяемый по определению.
Аноним 24/04/17 Пнд 22:43:05  410879
как определить сколько на остальных электронов ? или без разницы ,можно любые числа ставить для нужной суммы
Аноним 24/04/17 Пнд 22:44:15  410880
>>410875
Всё очевидно, если отождествить подмножества со своими характеристическими функциями в поле из двух элементов, симметрическую разность — со сложением этих функций, пересечение — с умножением этих функций.
Аноним 24/04/17 Пнд 22:44:26  410881
>>410878
Задача в ответе каждый из вопросов и обосновании этих ответов. Фиг знает, для меня вообще тарабарщина, а вечером разбираться откуда ноги растут зело ленно, вот, задаю вопрос здесь в надежде на доброго анона. Взамен могу рассказать что-нибудь про унылый код, планирование или кулстори из путешествий, вооот.
Аноним 24/04/17 Пнд 22:48:25  410882
>>410880
То есть:
>Является ли множество всех подмножеств произвольного множества группой относительно операции симметрической разницы?
Вроде да, сложение функций обратимо.
>Является ли данное множество кольцом, относительно операции симметрической разницы (аналог сложения) и операции пересечения множеств (аналог умножения)?
Да, функции образуют кольцо.
>Является ли данное множество полем, относительно операции симметрической разницы (аналог сложения) и операции пересечения множеств (аналог умножения)?
Нет если в области больше одного элемента, в кольце функций есть делители нуля (функции, которые не всё отображают в ноль, но их произведение всё отображает в ноль).

Надеюсь не ошибся.
Аноним 24/04/17 Пнд 22:48:58  410883
>>410881
Пока ты здесь пиздишь и ждёшь ответа того, кто эту хуйню ещё помнит - ты уже мог бы сам в этих определениях прекрасно разобраться. Just do it, короче, и зефирки ждут тебя.
Аноним 24/04/17 Пнд 22:49:32  410884
>>410883
Ебать, звучить как челлендж.
Аноним 24/04/17 Пнд 23:03:42  410885
1492051242698.jpg (129Кб, 928x882)
>>409550 (OP)
Если нейроны не образуются новые, то почему мозг так разрастается за время развития?
Аноним 25/04/17 Втр 06:45:28  410892
>>410885
Нейроны можно генерировать, но не регенерировать. Они создаются в определенном участке мозга.
Аноним 25/04/17 Втр 09:06:05  410894
>>410885
Они образуются, восстанавливаются. Гугли нейрогенезис.
Аноним 25/04/17 Втр 09:07:09  410895
>>410879
Каждая орбиталь и подорбиталь имеет о пределенные пределы энергитических уровней. Поищи таблицу.
Аноним 25/04/17 Втр 09:56:40  410900
>>410894
>нейрогенезис.
Вот что бывает когда в школах вместо биологии учат музыку :(
Аноним 25/04/17 Втр 10:24:20  410905
Сингулярность - это портал в другое измерение?
Аноним 25/04/17 Втр 12:25:45  410915
>>410870
Ты что, дурачок? Ими семьи занимались. И элитные заведения.
Аноним 25/04/17 Втр 12:31:34  410916
>>410915
Ну и? Почему некоторые из тех кем раньше занимались семьи и элитные заведения становились знаменитыми, а сейчас не становятся?
Аноним 25/04/17 Втр 17:46:22  410933
a089097a4e3386c[...].jpg (524Кб, 960x1200)
Я собираюсь немного похикковать по европам и посетить несколько тату-салонов, где могут полулегально сделать не очень сложную операцию. Допустим, я не позволю отрезать себе конечность, хотя об этом тоже хотелось бы почитать и найти источник актуальной информации. Но если говорить о менее радикальных вещах, то что я могу в себя засунуть? Из очевидного - неодимовые магниты в подушечки пальцев и rfid/nfc/светящиеся-чипы куда попало.
Аноним 25/04/17 Втр 17:58:55  410937
>>410933
Наука - это прежде всего про целесообразность, а не про дешёвые понты. Зачем тебе что-то в себя пихать?
Аноним 25/04/17 Втр 18:08:44  410938
>>410937
Автоматизация, удобство. Зачем носить ключи-пароли, если можно вшить их в руку? Зачем ограничивать свое восприятие, если доступны новые технологии? Я хочу все что наука может предложить.
Аноним 25/04/17 Втр 19:31:32  410942
Если пространственная бесконечность будет состоять из бесконечно малых, по отношению к понятию бесконечности, элементов, уместно ли будет наличие границ данной системы?
Аноним 25/04/17 Втр 22:13:49  410945
почему не говорят при знакомсте со шкурами что у мен недоеб или спермотоксикоз
Аноним 25/04/17 Втр 22:29:17  410946
>>409550 (OP)
Где можно ознакомится с методичкой по которой признакам приписывают статус врождённого и приобретённого? Если подходить с позиции чистого педантства, то врождённым может быть признак только тот с которым ты из мамы вылез, но как я понял в биологии терминология несколько иная если они считают, что такие признаки как например цвет глаз и сексуальная ориентация являются врождёнными, ведь в первом случае большинство детей(европейских) меняет цвет глаз в возрасте от 1 до 3х лет, а сексуальность как таковая возникает минимум в 4 года. Видимо у них признак появившийся в постнатальном онтогенезе может считаться врождённым, хотелось бы знать как происходит классификация.
Аноним 25/04/17 Втр 22:42:34  410947
>>410892
>>410894
Немного нытья, можно не читать.
Я последние 5 лет, как и многие двачеры проебал очень сильно здоровье из-за хуевого образа жизни, но больше всего почему то ударило по мозгам. Стал намного тупее, проебал память, сейчас отвратная скорость и пластичность, очень трудно переключастья на другие задачи, кратковременная памать чуть лучше чем нихуя, новая инфа почти не запоминается. Врачи блять, кто бы сомневался говорят здоров как бык.
Можно ли как-то стимулировать нейрогенез и опять стать нормальным?
Аноним 25/04/17 Втр 22:46:22  410948
>>410947
Ты и правда тупой. Дело не в том сколько у тебя нейронов, а в том сколько связей между ними. ВНЕЗАПНО надо много думать чтобы они образовывались. Стимулируй учебниками, быдло.
Аноним 25/04/17 Втр 23:09:02  410949
>>410948
Попизди мне тут, я уверен что дал бы тебе за щеку по знаниям и сообразительности лет 5 назад.
Аноним 25/04/17 Втр 23:28:26  410952
>>410949
>лет 5 назад.
у тебя и хуй стоял, да?
Аноним 25/04/17 Втр 23:33:02  410953
>>410952
Хуй стоит и сейчас заебись, а вот мозги совсем разжижели. Даже руки трясуться бывает и качает в стороны если закрывать глаза. Наверное учебниками перестимулировал.

25 лвл
Аноним 26/04/17 Срд 00:00:10  410955
Вопрос, почему наука такое отсталое дно? Разве учёные не должны быть на острие прогресса?

Как известно, человечество жило во тьме и невежестве до создания git(hub) и bitbucket. Утрирую, но всё же, контроль версий и общая открытая площадка были серьёзными шагами вперёд. А в науке (в естественных науках) мы по-прежнему пердолимся с отдельными статьями, маленькими выборками и преимущественно закрытыми данными. Причём отрицательные результаты сложно опубликовать, а опровержение высокопрофильной статьи вообще почти невозможно. Люди (я) работают с литературой, которая представляет из себя не максимально истинный на этот момент времени гипертекст, а какие-то устаревающие малоинформативные pdf-ки по частным случаям. Как в 14 веке. Допустим нейробио. Каждый год выходят статьи, которые, если им верить, открывают точные функции всех областей коры и отдельных типов нейронов, все сети и сигнальные пути. Дважды. На следующий год всё повторяется.

Доколе, и что тут можно сделать?
Аноним 26/04/17 Срд 00:29:01  410957
>>410955
Ну и как ты будешь искать инфу без оценки ее компетентными людьми и изданиями? Любой школьник или кефирщик-торсионщик сможет загаживать информационное пространство.

>Вопрос, почему наука такое отсталое дно
Пиздеж уровня /b/
>Как известно, человечество жило во тьме и невежестве до создания git(hub) и bitbucket.
Пиздеж уровня борщехлебов из /pr/
>Утрирую, но всё же, контроль версий и общая открытая площадка были серьёзными шагами вперёд.
Пиздеж уровня /po/
Аноним 26/04/17 Срд 00:57:22  410959
>>410957
Рецензии пишут учёные, а не журналы. В остальном пошёл нахуй, ты не можешь ответить.
Аноним 26/04/17 Срд 01:09:15  410960
>>410959
Ты сначала первый курс закончи, мамкин революционер
Аноним 26/04/17 Срд 01:12:46  410962
>>410960
Второй год аспы.
Аноним 26/04/17 Срд 01:16:10  410963
>>410955
>почему наука такое отсталое дно?
Потому что усиленное изучение реальности низшими слоями общества несколько опасно для высших слоев. Это не программирование, где результат ограничен возможностями железа. Изучив реальность вы можете всё в этом мире. Поэтому никакой открытой науки, а только необходимые для работы знания.
Аноним 26/04/17 Срд 01:21:45  410964
>>410963
Почаще в комнате проветривай
Аноним 26/04/17 Срд 01:34:34  410965
>>410955
>Разве учёные не должны быть на острие прогресса?
Ученые обслуживают в первую очередь интересы господ, в деле улучшения иерархической системы общества, где сильный паразитирует на слабом. Это противоречит полному доступу к достоверной информации, иначе ученый будет угрожать стабильности такой системы.
Аноним 26/04/17 Срд 05:52:48  410968
lol.png (1694Кб, 1053x1070)
Какое шифрование использовать, чтобы его не могли вскрыть квантовые компьютеры в подвалах АНБ?
Аноним 26/04/17 Срд 08:18:48  410969
>>410968
Так как тебе неудобно будет прокинуть квантовое оптоволокно, то лучше постквантовую криптографию.

https://ru.wikipedia.org/wiki/%D0%9F%D0%BE%D1%81%D1%82%D0%BA%D0%B2%D0%B0%D0%BD%D1%82%D0%BE%D0%B2%D0%B0%D1%8F_%D0%BA%D1%80%D0%B8%D0%BF%D1%82%D0%BE%D0%B3%D1%80%D0%B0%D1%84%D0%B8%D1%8F

Удивляюсь почему на нее не так переходят быстро.
Аноним 26/04/17 Срд 08:24:58  410970
>>410955
Скажу больше по технической части. Современный интернет говно и гипертекста там нет. В самом начале идея полноценного гипертекста шла с проектом XANADU, который решал этот и другие вопросы, но некоторые умники решили сляпать по быстрому типа "гипертекст" и получился интернет.
Аноним 26/04/17 Срд 09:25:03  410978
>>410800
А с дробями у тебя как? Как в школе учился-то по математике?
Гугли любой школьный учебник или онлайн-курсы.
Аноним 26/04/17 Срд 09:34:07  410979
IMG5734.PNG (77Кб, 640x651)
Вопрос к тем, кто имеет ясное представление о теореме о конце света и хорошо разбирается в ней. Объясните мне пикрелейтед. Почему несогласие с DA определяет её истинность? Потому что есть такое "условие" как согласие со статистическими методами? Я правильно понял? Получается вполне логично.
Аноним 26/04/17 Срд 10:02:25  410981
>>410978
https://interneturok.ru/uchyonye-detyam/dlya-shkolnikov/lektsii-savvateeva-a-v-po-matematike-interneturok-ru/drobi?seconds=0&chapter_id=2403 тут хорошо о дробях, переводят их на координатную плоскость.
Аноним 26/04/17 Срд 10:39:55  410985
>>410981
Лол, зачем ты мне это скинул? Я спросил об успеваемости.
Аноним 26/04/17 Срд 12:52:59  410988
Что является чистой энергией?
Аноним 26/04/17 Срд 13:03:51  410990
Почему электроны вращаются вокруг ядра, а не просто притягиваются к нему?
Аноним 26/04/17 Срд 13:15:06  410992
ssadasdss.png (27Кб, 1232x582)
>>410979
>Почему несогласие с DA определяет её истинность?
Мне кажется, потому, что DA сама себя опровергает.
Аноним 26/04/17 Срд 13:28:24  410994
>>410988
Масса умноженная на скорость света в квадрате.
Аноним 26/04/17 Срд 13:59:56  410995
Почему мгновенная скорость наверху обода колеса равна удвоенное линейной, внизу - нулю, а по бокам - просто линейной скорости?
Аноним 26/04/17 Срд 14:23:23  410997
>>410995
первая ссылка, совсем сложно?
https://www.google.ru/search?q=%D1%81%D0%BA%D0%BE%D1%80%D0%BE%D1%81%D1%82%D1%8C+%D0%B3%D1%83%D1%81%D0%B5%D0%BD%D0%B8%D1%87%D0%BD%D0%BE%D0%B3%D0%BE+%D0%B2%D0%B5%D0%B7%D0%B4%D0%B5%D1%85%D0%BE%D0%B4%D0%B0&oq=crjhjcnm+uect&aqs=chrome.2.69i57j0l5.9362j0j4&sourceid=chrome&ie=UTF-8#newwindow=1&q=%D1%81%D0%BA%D0%BE%D1%80%D0%BE%D1%81%D1%82%D1%8C+%D0%BA%D0%BE%D0%BB%D0%B5%D1%81%D0%B0+%D0%B2+%D1%80%D0%B0%D0%B7%D0%BD%D1%8B%D1%85+%D1%82%D0%BE%D1%87%D0%BA%D0%B0%D1%85
Аноним 26/04/17 Срд 16:25:30  411004
Кто знает как правилно записывать точки ковалентной свзязи ? Есть какое нить правило ?
Аноним 26/04/17 Срд 18:31:34  411013
>>410990 поведение электрона в отдельном атоме. Здесь также необходимо понять, почему электрон не падает на ион, а в возбужденном атоме проводит почти все время вдали от ядра. Что мешает ему проникать в близкую к ядру область с низкой потенциальной энергией? Дело в том, что во внутренних областях волновая функция электрона испытывает множество быстрых осцилляций, которым отвечает большая кинетическая энергия: она “съедает” всю выгоду от понижения потенциальной. Именно поэтому в возбужденном атоме электрон старается быть подальше от внутренней области быстрых осцилляций.
Аноним 26/04/17 Срд 18:37:10  411015
>>411013
А попроще можешь объяснить?
Аноним 26/04/17 Срд 18:40:02  411018
>>411015
Куда уж проще-то?
Аноним 26/04/17 Срд 18:56:55  411021
65[1].jpg (19Кб, 550x277)
image001.jpg (9Кб, 481x187)
image75[1].gif (5Кб, 558x149)
image003[1].gif (2Кб, 355x162)
>>411004
Точки - это неспаренные электроны на электронных оболочках.
Ковалентная связь - связь за счёт общего электронного облака из спаренных электронов.
Пикрелейтед.
Аноним 26/04/17 Срд 19:02:07  411022
>>410992
>Мне кажется, потому, что DA сама себя опровергает.
В каком месте?
Аноним 26/04/17 Срд 19:58:07  411026
>>409837
И что из этого следует по-твоему?
Аноним 26/04/17 Срд 20:04:28  411027
>>409837
Лови шизика!
Аноним 26/04/17 Срд 20:36:12  411029
>>411027
>Лови
Зачем?
>>411022
>В каком месте?
В пизде твоей мамаши
Аноним 26/04/17 Срд 21:05:07  411037
>>409837
Я тебе чуток информатики принёс:
http://gen.lib.rus.ec/search.php?req=Информатика
Аноним 26/04/17 Срд 21:38:49  411039
>>410988
ldb;tybt 'abhf
Аноним 26/04/17 Срд 21:40:36  411040